PRGDB00073913 (Pgl.25355)

From PRG Wiki
Jump to: navigation, search
Pgl.25355
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157567589 (EX368817)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03215.B7_B07 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03215_B07 5', mRNA sequence

DNA Sequence

ATCCACCCAGTAGCTGGGACACTGGGGTACATGCCTCCAGAGTATGCATGTGGATCCATTGCTACGAAGCAAGCTGATGTTTACAGCGTTGGAATGTTGATGATGGAGATTGCCACTGGGAGGAGGCCTCACCTTTGTATCAAGGAGGACAGCCACAGGAGGACTCTCTGGAGCTGGGTGCGTGAACTGATGGAAGAGAAACGACACATGGACTTAGTCGATGAATTAATTAGAGAATCATTGAACTCTGACCAGCATTCGGAGAAGGAAGTATTTGAGTCTCTAAGAATTGGGTGTCTATGCACGTCTCTTAAATCCGAAGATAGACCTTTAATGCGAGATGTTGTCTCTATGCTGGAAGCTCTAGCTCCCCAAGACATAGATTGAGGTAAAGTGTTCCACTTTTTCTTATCAATCCAGGTTTCGTTGGCTCTTGTCTGTGATATTTGGGTCCATATATTACCTGCTTGCATGGATCCATATCCACGGGTAGTTGGTCTTGAATTCTTTGTAACTTTAATCATTGTATCATTGCCAGTAGCTATTAGAAATGTAGTTCAATCCAAAGTAAGAGAAAATTTGGCGAATGCCAAAGGAACACATGAACTACTACAGTAAGGAAATAAATCCTATGGTTATTTATGAGGAATGTAAATACTAACAGAAGCCCATGTCAGTCTTCAAAAGACAATTGATATGTAGGATAAGGATGAGTTCACAAACCCTAGAAATTGGAACAAGAAGATGGAAACAAATGGAAAAAAGAGAACACAGATGTCTTCTATGTGATGAACAATTCTTTGAAGATGAAACTCGTGTGCTGCTAAATTGTTCTAGATATGACGAACTCAGATTTAAGCATTCAAGGCATCAATTTCAGTCCAAAGGGCTGAATGCTTTGTT


Protein sequences

Name Description Sequence
Pgl.25355 translated coding region predicted by ESTScan from UniGene Pgl.25355

IHPVAGTLGYMPPEYACGSIATKQADVYSVGMLMMEIATGRRPHLCIKEDSHRRTLWSWVRELMEEKRHMDLVDELIRESLNSDQHSEKEVFESLRIGCLCTSLKSEDRPLMRDVVSMLEALAPQDID

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-112 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

IHPVAGTLGYMPPEYACGSIATKQADVYSVGMLMMEIATGRRPHLCIKEDSHRRTLWSWVRELMEEKRHMDLVDELIRESLNSDQHSEKEVFESLRIGCLCTSLKSEDRPLM

HMMPfam: PF00069
IPR017442
3-82 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

PVAGTLGYMPPEYACGSIATKQADVYSVGMLMMEIATGRRPHLCIKEDSHRRTLWSWVRELMEEKRHMDLVDELIRESLN

superfamily: SSF56112
IPR011009
4-119 Protein kinase-like (PK-like)
Protein kinase-like domain

VAGTLGYMPPEYACGSIATKQADVYSVGMLMMEIATGRRPHLCIKEDSHRRTLWSWVRELMEEKRHMDLVDELIRESLNSDQHSEKEVFESLRIGCLCTSLKSEDRPLMRDVVSML

HMMPanther: PTHR24420
4-124 FAMILY NOT NAMED,FAMILY NOT NAMED

VAGTLGYMPPEYACGSIATKQADVYSVGMLMMEIATGRRPHLCIKEDSHRRTLWSWVRELMEEKRHMDLVDELIRESLNSDQHSEKEVFESLRIGCLCTSLKSEDRPLMRDVVSMLEALAP

Gene3D: G3DSA:1.10.510.10
4-121 no description

VAGTLGYMPPEYACGSIATKQADVYSVGMLMMEIATGRRPHLCIKEDSHRRTLWSWVRELMEEKRHMDLVDELIRESLNSDQHSEKEVFESLRIGCLCTSLKSEDRPLMRDVVSMLEA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox