PRGDB00073948 (Pin.357)

From PRG Wiki
Jump to: navigation, search
Pin.357
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 58140003 (CV950247)
Gene Class Unknown
Domain Type
Gene Species Phytophthora infestans

Comment?

PVrpvb_3509 zoospores, purified Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

ccggtccggaattcccgggtcgacccacgcgtccgAGAGTACGTCTGGTTTGGCATTGGCATTCTGGTGGCCTACTACCTGTTCTTCACGACGTTGAACGGGCTGGCGCTGCACTTCATCTGCTACGAAAAGTACAAGGGTGTTAGTGTGAAGTCCATGACGGACAACGCTCCGGAGGAAGACAACGTGTACGTGGAAGTGCGCACGCCCGGGTCCGGGGACGTCGTGCAGGCAAAGGCCCGTGGCGCCGGTCTGCCGTTCACGCCGTCGAACTTGTGCATCAAGGACTTGGAGTACTTCGTGACGCTGCCGTCGGGCGAAGAGAAGCAGCTACTGCGTGGCATTACGGCGCACTTCGAGCCCGGTCGCATGGTGGCTCTTATGGGTGCAACGGGTGCCGGCAAGACGACGCTGATGGACGTGATCGCCGGCCGCAAAACGGGCGGACGCATTGTTGGTGACATCATCGTGAACGGCGAGGCCAAGAACCCGGCCAACTTCAGTCGCATCACGGCGTACTGCGAGCAGATGGACATTCACTCGGAGGCCGCGACGATCTACGAGGCGCTGGTTTTCTCCGCCAACCTACGATTGCCTCCCACGTTCACGGAGAAGGAGCGGATGAACCTTGTGAGCGAGACGCTGGAGCTGCTGGAGCTGTCGCCTATCGCTGGCGAGATGGTGGGTCGCTTGTC


Protein sequences

Name Description Sequence
Pin.357 translated coding region predicted by ESTScan from UniGene Pin.357

PVRNSRVDPRVREYVWFGIGILVAYYLFFTTLNGLALHFICYEKYKGVSVKSMTDNAPEEDNVYVEVRTPGSGDVVQAKARGAGLPFTPSNLCIKDLEYFVTLPSGEEKQLLRGITAHFEPGRMVALMGATGAGKTTLMDVIAGRKTGGRIVGDIIVNGEAKNPANFSRITAYCEQMDIHSEAATIYEALVFSANLRLPPTFTEKERMNLVSETLELLELSPIAGEMVGRLS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF10
85-232 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

LPFTPSNLCIKDLEYFVTLPSGEEKQLLRGITAHFEPGRMVALMGATGAGKTTLMDVIAGRKTGGRIVGDIIVNGEAKNPANFSRITAYCEQMDIHSEAATIYEALVFSANLRLPPTFTEKERMNLVSETLELLELSPIAGEMVGRLS

HMMPanther: PTHR19241
85-232 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

LPFTPSNLCIKDLEYFVTLPSGEEKQLLRGITAHFEPGRMVALMGATGAGKTTLMDVIAGRKTGGRIVGDIIVNGEAKNPANFSRITAYCEQMDIHSEAATIYEALVFSANLRLPPTFTEKERMNLVSETLELLELSPIAGEMVGRLS

superfamily: SSF52540
92-232 P-loop containing nucleoside triphosphate hydrolases

LCIKDLEYFVTLPSGEEKQLLRGITAHFEPGRMVALMGATGAGKTTLMDVIAGRKTGGRIVGDIIVNGEAKNPANFSRITAYCEQMDIHSEAATIYEALVFSANLRLPPTFTEKERMNLVSETLELLELSPIAGEMVGRLS

Gene3D: G3DSA:3.40.50.300
93-232 no description

CIKDLEYFVTLPSGEEKQLLRGITAHFEPGRMVALMGATGAGKTTLMDVIAGRKTGGRIVGDIIVNGEAKNPANFSRITAYCEQMDIHSEAATIYEALVFSANLRLPPTFTEKERMNLVSETLELLELSPIAGEMVGRLS

Seg: seg
213-220 seg

ETLELLEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox