PRGDB00073949 (Pin.1121)

From PRG Wiki
Jump to: navigation, search
Pin.1121
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 239849546 (GR292333)
Gene Class Unknown
Domain Type
Gene Species Phytophthora infestans

Comment?

G969P322FG11.T0 Phytophthora infestans T30-4 NORMALIZED Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

TTTAACGTTTGAGGTGGCTAATGTAGCGAAGAGAAATCAGCGCCAGCACGCGGAATACCACGATGAGGATGATGAGGATCATGGCGTTTCTCCAAATGTCATCGTGCTTCATGTCAAACGTGTCCTCGACGTACTGCTTGAGGGTCATGTCTCCGATATTGGGAGGAGCATCCTGCATGGCATCACAACCCACCTTGGAACCCGAACAATCTCCAAAGACCAGTGCAACCAAGATAGCAATGCTGTAGGTGGGCGGTGAGACCCAGTGGACCCACATGTATCCTTCCGGAATGCTCCCCGTGGGCGGGTTGAAGCCGGCAAACAGCATGAAGATGGAGCTGAGTAGAGCTCCGAGCGTAGTCGCGACAGCCACACTAGGTAGAGCGTACACCAGCAACTGACCGAGATACACGAACACCAAAGCGTTCATGGAGACCACGAGCCAATAGTAGAAGAACGTAATGTAACCAGTAAAGCCTACGCTCGGGTAGAAGATGACCATGAACAGTAAGCTCGAGAAGAAGATGTACGGGATCTCCACCAGTGTACCGGCAATGAAATACCACAGCGCGTTGTAAGTCTGCGATGCACGCTCACGGTAGAAGGCTGTGCGTTCGTCGGCAGCCACAGGCATGACACTGTTGAAGCTGATAATACCCAAGAACACGGTACTCACGAGATCAGACCGATGCCGGCGTTGGCTCCCACTGTACGTGTTGTAGTCGGTCCTTGGTAGATATAGCGAAGACCACAGGCGAGCCCGATGCTGATCATCAAACCGCTTG


Protein sequences

Name Description Sequence
Pin.1121 translated coding region predicted by ESTScan from UniGene Pin.1121

XKRFDDQHRARLWSSLYLPRTDYNTYSGSQRRHRSDLVSTVFLGIISFNSVMPVAADERTAFYRERASQTYNALWYFIAGTLVEIPYIFFSSLLFMVIFYPSVGFTGYITFFYYWLVVSMNALVFVYLGQLLVYALPSVAVATTLGALLSSIFMLFAGFNPPTGSIPEGYMWVHWVSPPTYSIAILVALVFGDCSGSKVGCDAMQDAPPNIGDMTLKQYVEDTFDMKHDDIWRNAMILIILIVVFRVLALISLRYISHLKRXX

Domains

Domain Start-End Description Sequence

HMMPfam: PF01061
IPR013525
39-190 ABC2_membrane
ABC-2 type transporter

STVFLGIISFNSVMPVAADERTAFYRERASQTYNALWYFIAGTLVEIPYIFFSSLLFMVIFYPSVGFTGYITFFYYWLVVSMNALVFVYLGQLLVYALPSVAVATTLGALLSSIFMLFAGFNPPTGSIPEGYMWVHWVSPPTYSIAILVALV

HMMPanther: PTHR19241:SF10
39-261 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

STVFLGIISFNSVMPVAADERTAFYRERASQTYNALWYFIAGTLVEIPYIFFSSLLFMVIFYPSVGFTGYITFFYYWLVVSMNALVFVYLGQLLVYALPSVAVATTLGALLSSIFMLFAGFNPPTGSIPEGYMWVHWVSPPTYSIAILVALVFGDCSGSKVGCDAMQDAPPNIGDMTLKQYVEDTFDMKHDDIWRNAMILIILIVVFRVLALISLRYISHLKR

HMMPanther: PTHR19241
39-261 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

STVFLGIISFNSVMPVAADERTAFYRERASQTYNALWYFIAGTLVEIPYIFFSSLLFMVIFYPSVGFTGYITFFYYWLVVSMNALVFVYLGQLLVYALPSVAVATTLGALLSSIFMLFAGFNPPTGSIPEGYMWVHWVSPPTYSIAILVALVFGDCSGSKVGCDAMQDAPPNIGDMTLKQYVEDTFDMKHDDIWRNAMILIILIVVFRVLALISLRYISHLKR

HMMPfam: PF06422
IPR010929
215-260 PDR_CDR
CDR ABC transporter

TLKQYVEDTFDMKHDDIWRNAMILIILIVVFRVLALISLRYISHLK

Seg: seg
237-251 seg

ILIILIVVFRVLALI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox