PRGDB00073951 (Pin.2709)

From PRG Wiki
Jump to: navigation, search
Pin.2709
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 10229757 (BE776102)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Phytophthora infestans

Comment?

MY-10-H-09 PinfestansMY Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

CACCAACATCTTGGAGATAAACTCTTTGGCATCTGTGGATACATTGTCCCAATAGGGCGAGTCGAAGTAGTATTTGCCCTTACGGATCTTCTTGAACAGAACGGGCTGCGAGTCGTCGTGGAAAGGAGGATAGCCACACAGCAGAATGTATGTGATGATGCCGATACTCCAGATATCAACGGGTTTCCCGTACGACGCGCCTTCCAAGATCTCTGGAGCCACATATCCGGGTGTGCCACACGTGGTCACAAGGCCAGAATTGTCTTTGGTCACAGTTTTCGCGAAGCCAAAGTCGGCGAGTTTGATACTGGCGTCGTCATCTGCTGACATAAGCAGTAGGTTCTCCGGTTTGAGGTCTCGGTGCACGACGTTTTGGTCGTGGCAATACTTGATGGCGTCGATGAGAATCTTGACGAGGTCGCGCGCCTCTTTTTCCGTGTAGAACGTTTTCTCCACGATGCGGTCGAAGAGTTCGCCGCCTTCGACGAACTCCGTAACGAGGTAGTAGTAGTCGGGATCGACGAAAAACTCCTCAAGAGTCATAATGTGCGGATGCTTCATCTGTTGCAGGATGGAAACCTCGAACTGAATGGCTTCGTNGTCCTCGGTTTGANAGTTCCGAGCGTTTGATGCACTTGATGGCGAATTTTGNGCNTGCTTNTCTTGNGAAACTCTCCCCC


Protein sequences

Name Description Sequence
Pin.2709 translated coding region predicted by ESTScan from UniGene Pin.2709

XGRVSQXKXAQNSPSSASNARNXQTEDXEAIQFEVSILQQMKHPHIMTLEEFFVDPDYYYLVTEFVEGGELFDRIVEKTFYTEKEARDLVKILIDAIKYCHDQNVVHRDLKPENLLLMSADDDASIKLADFGFAKTVTKDNSGLVTTCGTPGYVAPEILEGASYGKPVDIWSIGIITYILLCGYPPFHDDSQPVLFKKIRKGKYYFDSPYWDNVSTDAKEFISKMLV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-227 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XGRVSQXKXAQNSPSSASNARNXQTEDXEAIQFEVSILQQMKHPHIMTLEEFFVDPDYYYLVTEFVEGGELFDRIVEKTFYTEKEARDLVKILIDAIKYCHDQNVVHRDLKPENLLLMSADDDASIKLADFGFAKTVTKDNSGLVTTCGTPGYVAPEILEGASYGKPVDIWSIGIITYILLCGYPPFHDDSQPVLFKKIRKGKYYFDSPYWDNVSTDAKEFISKMLV

HMMSmart: SM00220
IPR002290
3-227 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RVSQXKXAQNSPSSASNARNXQTEDXEAIQFEVSILQQMKHPHIMTLEEFFVDPDYYYLVTEFVEGGELFDRIVEKTFYTEKEARDLVKILIDAIKYCHDQNVVHRDLKPENLLLMSADDDASIKLADFGFAKTVTKDNSGLVTTCGTPGYVAPEILEGASYGKPVDIWSIGIITYILLCGYPPFHDDSQPVLFKKIRKGKYYFDSPYWDNVSTDAKEFISKMLV

Seg: seg
5-24 seg

SQXKXAQNSPSSASNARNXQ

HMMSmart: SM00219
IPR020635
8-226 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

KXAQNSPSSASNARNXQTEDXEAIQFEVSILQQMKHPHIMTLEEFFVDPDYYYLVTEFVEGGELFDRIVEKTFYTEKEARDLVKILIDAIKYCHDQNVVHRDLKPENLLLMSADDDASIKLADFGFAKTVTKDNSGLVTTCGTPGYVAPEILEGASYGKPVDIWSIGIITYILLCGYPPFHDDSQPVLFKKIRKGKYYFDSPYWDNVSTDAKEFISKML

Gene3D: G3DSA:3.30.200.20
24-94 no description

QTEDXEAIQFEVSILQQMKHPHIMTLEEFFVDPDYYYLVTEFVEGGELFDRIVEKTFYTEKEARDLVKILI

HMMPfam: PF00069
IPR017442
24-226 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

QTEDXEAIQFEVSILQQMKHPHIMTLEEFFVDPDYYYLVTEFVEGGELFDRIVEKTFYTEKEARDLVKILIDAIKYCHDQNVVHRDLKPENLLLMSADDDASIKLADFGFAKTVTKDNSGLVTTCGTPGYVAPEILEGASYGKPVDIWSIGIITYILLCGYPPFHDDSQPVLFKKIRKGKYYFDSPYWDNVSTDAKEFISKML

superfamily: SSF56112
IPR011009
29-227 Protein kinase-like (PK-like)
Protein kinase-like domain

EAIQFEVSILQQMKHPHIMTLEEFFVDPDYYYLVTEFVEGGELFDRIVEKTFYTEKEARDLVKILIDAIKYCHDQNVVHRDLKPENLLLMSADDDASIKLADFGFAKTVTKDNSGLVTTCGTPGYVAPEILEGASYGKPVDIWSIGIITYILLCGYPPFHDDSQPVLFKKIRKGKYYFDSPYWDNVSTDAKEFISKMLV

HMMPanther: PTHR24349
34-227 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE

EVSILQQMKHPHIMTLEEFFVDPDYYYLVTEFVEGGELFDRIVEKTFYTEKEARDLVKILIDAIKYCHDQNVVHRDLKPENLLLMSADDDASIKLADFGFAKTVTKDNSGLVTTCGTPGYVAPEILEGASYGKPVDIWSIGIITYILLCGYPPFHDDSQPVLFKKIRKGKYYFDSPYWDNVSTDAKEFISKMLV

Gene3D: G3DSA:1.10.510.10
95-226 no description

DAIKYCHDQNVVHRDLKPENLLLMSADDDASIKLADFGFAKTVTKDNSGLVTTCGTPGYVAPEILEGASYGKPVDIWSIGIITYILLCGYPPFHDDSQPVLFKKIRKGKYYFDSPYWDNVSTDAKEFISKML

PatternScan: PS00108
IPR008271
105-117 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDLKPENLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox