PRGDB00073952 (Pin.3244)

From PRG Wiki
Jump to: navigation, search
Pin.3244
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 146440741 (ES460784)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Phytophthora infestans

Comment?

piTB017xH21.b1.ab1 PiTB - Interaction library between Potato tuber and Phytophthora infestans Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

GCGGCCGCCCGGGCAGGTCTGACTTGGGCCAACTTGAAGTGCCAGATCGCCATCGATATCGCCGATGCGCGCGTGTAACTCCACACACTGAACCCCAAGCTCATCCATCGTGACTTAAAGTCGCGAAATGTGCTGATTGACGCGCAGACGGGCGCGAAACTGAGTGATTTCGGTATCTTGCGTAACCGTAGCTTTGACGAGACCATGACGGCTGGAGTGGGTACAGCTCGCTGGATCGCACCCGAGGTGATTCTGGGCGGACATTACACTGAGTTCGCCGATATCTACTCGTTCGGAGTGGTGCTGTCTGAGCCGGACACGTGTAAGGCGCCGTTCTACGACGCTACCAACACGAACGGCGGCAAGATGCAGGACGTGACGATCCTGCAACTTGTGTCGGCCGGAAAATTGCAGCCGAGCTTCAGCGACTCGTGTCCGCCTTCCATCGTCAAGCTGGCGCGCGTGTGTCTGTCGTTCGACCCTGCGCAACGTCCGAGCGCCATCCACATTTCGTACGAACTACGCAAGATCATGAAGGACGAGCTGTAGACAAGAAGCGAAGCTGGTGTTTTTGGTAGCAATGGAGGCTCTTTTGTATTACCTCGGCTGAATTCANAGTCTAACATTNTAAGGACaaaaaaaaatannaaaaaaaaaaaaaaaaGCTTGTACCTCGGCCGCGACCACGC


Protein sequences

Name Description Sequence
Pin.3244 translated coding region predicted by ESTScan from UniGene Pin.3244

AAARAGLTWANLKCQIAIDIADARVXLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGILRNRSFDETMTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSEPDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSFSDSCPPSIVKLARVCLSFDPAQRPSAIHISYELRKIMKDEL

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-182 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

AAARAGLTWANLKCQIAIDIADARVXLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGILRNRSFDETMTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSEPDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSFSDSCPPSIVKLARVCLSFDPAQRPSAIHISYELRKIMKDEL

HMMSmart: SM00219
IPR020635
1-174 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

AAARAGLTWANLKCQIAIDIADARVXLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGILRNRSFDETMTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSEPDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSFSDSCPPSIVKLARVCLSFDPAQRPSAIHISYEL

HMMPanther: PTHR23257:SF99
12-181 TGF-BETA-ACTIVATED KINASE 1,TGF-BETA-ACTIVATED KINASE 1

LKCQIAIDIADARVXLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGILRNRSFDETMTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSEPDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSFSDSCPPSIVKLARVCLSFDPAQRPSAIHISYELRKIMKDE

HMMPanther: PTHR23257
12-181 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

LKCQIAIDIADARVXLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGILRNRSFDETMTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSEPDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSFSDSCPPSIVKLARVCLSFDPAQRPSAIHISYELRKIMKDE

HMMSmart: SM00220
IPR002290
13-178 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KCQIAIDIADARVXLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGILRNRSFDETMTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSEPDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSFSDSCPPSIVKLARVCLSFDPAQRPSAIHISYELRKIM

Gene3D: G3DSA:1.10.510.10
14-170 no description

CQIAIDIADARVXLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGILRNRSFDETMTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSEPDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSFSDSCPPSIVKLARVCLSFDPAQRPSAIHI

superfamily: SSF56112
IPR011009
14-174 Protein kinase-like (PK-like)
Protein kinase-like domain

CQIAIDIADARVXLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGILRNRSFDETMTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSEPDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSFSDSCPPSIVKLARVCLSFDPAQRPSAIHISYEL

HMMPfam: PF00069
IPR017442
15-170 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

QIAIDIADARVXLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGILRNRSFDETMTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSEPDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSFSDSCPPSIVKLARVCLSFDPAQRPSAIHI

PatternScan: PS00108
IPR008271
34-46 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

LIHRDLKSRNVLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox