PRGDB00073953 (Pin.3290)

From PRG Wiki
Jump to: navigation, search
Pin.3290
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 58151224 (CV961433)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Phytophthora infestans

Comment?

PYrpcy_4550 mycelium, Plich medium Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

ggaaagtggtacgcctgcaggtccggtccggaattcccgggtcgacccacgcgtcGCAGAAGGTAAGATTCCACATTTCCTTTCAGCCTGGTTCAATGCCGGTCGTGACACAAAGGCCACCAACGACACCGACAACAGCGACGCCGAGTCAGCCAAGACCGACCTGACTATTATCAGTATTGACGAGAAGGATTTCCGGTCGAGCCTGTGAAACAAGAGGCCAATGCTGCGGCCAAGCCTCCGCCAGCTCCAGTCGAAGTGTCTAAGGACAAAACAGCGATGAAACACAGACCCACGAGCTACAGCCAGAACATCAACTTCAGCGAGATCACTTTGGGCCGGATGATCGGAGAAGGCGCTTTTGGCAAAGTACACGAAGGCAAATGGCGTGGCAAAAGTGTTGCCGTCAAGTTGCTTATCTGCCAAGACTTGCGAAGCGACATTCTAAGACGAGTTTCAGTCCGAGGTGGAAATTATGAGTGTGCTGCGTCACCCGAATATTTGCCGACTTTTGGGCGCGTGTATGGAGCCGCCACACCGCGCGCTTGTGGTGGAGCTGTTGCAACGCGGATCGCTGTGGGGAGTGCTGCGAATGAACCGCAAATCGATCGACCAGGAGATGAGATCGCGCTTTATCTACGACACGGCCAAGGGCATGTCGTATTTGCACCACTTTGAGCGCCCTATTTTGCACCGAGATTTGAAAAGTCCCAATTTGCTCGTGGACAAAAACTTCAACATCAAGCTGTCGGACTTTGGCCTTGCTCGAGTGAAGGCTCATGTGCAAACCATGACAGGCAATTGCGGTACTGTCCAGTGGATGGCACCGGAAGTACTGGGCAACCAAAAGTACACAGAGAAGGCCGACGTCTTCTCGTTTGGCATTGTCATTTGGGAGATTGTTACAGGTGAGTGCCCGTACGACGGCATGAGTCAGATTCAGGCCGCGCTCGGTGTGCTAAACCGCAACTTGAAGGCCAATATCCCTCG


Protein sequences

Name Description Sequence
Pin.3290 translated coding region predicted by ESTScan from UniGene Pin.3290

XESGTPAGPVRNSRVDPRVAEGKIPHFLSAWFNAGRDTKATNDTDNSDAESAKTDLTIISIDXEGFPVEPVKQEANAAAKPPPAPVEVSKDKTAMKHRPTSYSQNINFSEITLGRMIGEGAFGKVHEGKWRGKSVAVKLLICQDLRSDILRRVSVRGGNYECAASPEYLPTFGRVYGAATPRACGGAVATRIAVGSAANEPQIDRPGDEIAFIYDTAKGMSYLHHFERPILHRDLKSPNLLVDKNFNIKLSDFGLARVKAHVQTMTGNCGTVQWMAPEVLGNQKYTEKADVFSFGIVIWEIVTGECPYDGMSQIQAALGVLNRNLKANIPR

Domains

Domain Start-End Description Sequence

Seg: seg
75-85 seg

ANAAAKPPPAP

superfamily: SSF56112
IPR011009
81-322 Protein kinase-like (PK-like)
Protein kinase-like domain

PPPAPVEVSKDKTAMKHRPTSYSQNINFSEITLGRMIGEGAFGKVHEGKWRGKSVAVKLLICQDLRSDILRRVSVRGGNYECAASPEYLPTFGRVYGAATPRACGGAVATRIAVGSAANEPQIDRPGDEIAFIYDTAKGMSYLHHFERPILHRDLKSPNLLVDKNFNIKLSDFGLARVKAHVQTMTGNCGTVQWMAPEVLGNQKYTEKADVFSFGIVIWEIVTGECPYDGMSQIQAALGVLN

Gene3D: G3DSA:3.30.200.20
96-151 no description

KHRPTSYSQNINFSEITLGRMIGEGAFGKVHEGKWRGKSVAVKLLICQDLRSDILR

HMMPanther: PTHR23257
98-325 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

RPTSYSQNINFSEITLGRMIGEGAFGKVHEGKWRGKSVAVKLLICQDLRSDILRRVSVRGGNYECAASPEYLPTFGRVYGAATPRACGGAVATRIAVGSAANEPQIDRPGDEIAFIYDTAKGMSYLHHFERPILHRDLKSPNLLVDKNFNIKLSDFGLARVKAHVQTMTGNCGTVQWMAPEVLGNQKYTEKADVFSFGIVIWEIVTGECPYDGMSQIQAALGVLNRNL

ProfileScan: PS50011
IPR000719
111-331 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ITLGRMIGEGAFGKVHEGKWRGKSVAVKLLICQDLRSDILRRVSVRGGNYECAASPEYLPTFGRVYGAATPRACGGAVATRIAVGSAANEPQIDRPGDEIAFIYDTAKGMSYLHHFERPILHRDLKSPNLLVDKNFNIKLSDFGLARVKAHVQTMTGNCGTVQWMAPEVLGNQKYTEKADVFSFGIVIWEIVTGECPYDGMSQIQAALGVLNRNLKANIPR

HMMSmart: SM00219
IPR020635
111-331 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ITLGRMIGEGAFGKVHEGKWRGKSVAVKLLICQDLRSDILRRVSVRGGNYECAASPEYLPTFGRVYGAATPRACGGAVATRIAVGSAANEPQIDRPGDEIAFIYDTAKGMSYLHHFERPILHRDLKSPNLLVDKNFNIKLSDFGLARVKAHVQTMTGNCGTVQWMAPEVLGNQKYTEKADVFSFGIVIWEIVTGECPYDGMSQIQAALGVLNRNLKANIPR

HMMSmart: SM00220
IPR002290
111-329 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

ITLGRMIGEGAFGKVHEGKWRGKSVAVKLLICQDLRSDILRRVSVRGGNYECAASPEYLPTFGRVYGAATPRACGGAVATRIAVGSAANEPQIDRPGDEIAFIYDTAKGMSYLHHFERPILHRDLKSPNLLVDKNFNIKLSDFGLARVKAHVQTMTGNCGTVQWMAPEVLGNQKYTEKADVFSFGIVIWEIVTGECPYDGMSQIQAALGVLNRNLKANI

PatternScan: PS00107
IPR017441
117-138 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGAFGKVHEGKWRGKSVAVK

Gene3D: G3DSA:1.10.510.10
211-325 no description

AFIYDTAKGMSYLHHFERPILHRDLKSPNLLVDKNFNIKLSDFGLARVKAHVQTMTGNCGTVQWMAPEVLGNQKYTEKADVFSFGIVIWEIVTGECPYDGMSQIQAALGVLNRNL

HMMPfam: PF00069
IPR017442
211-317 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

AFIYDTAKGMSYLHHFERPILHRDLKSPNLLVDKNFNIKLSDFGLARVKAHVQTMTGNCGTVQWMAPEVLGNQKYTEKADVFSFGIVIWEIVTGECPYDGMSQIQAA

PatternScan: PS00108
IPR008271
230-242 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHRDLKSPNLLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox