PRGDB00073957 (Pin.7137)

From PRG Wiki
Jump to: navigation, search
Pin.7137
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 146433203 (ES453246)
Gene Class Unknown
Domain Type
Gene Species Phytophthora infestans

Comment?

piTE002xP14.b1.ab1 PiTE - Interaction library between Potato tuber and Phytophthora infestans Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

GCGTGGTCGCGGCCGAGGTACCATTCATCAGCCTAGCATTGACATTTTCGAGGCTTTTGATGAGTTGTTTCTCATGAAACGAGGAGGACAAGAGATATACGTTGGTCCATTAGGTCGCGTATTTTGCTATTTGATAAAATATTTCGAGTCCATGCCCGGTGTTGGCAAAATAGAGGAAGGTTACAATCCAGCAACTTGGACGTTAGAAGTCACATCCTCATCTCCAAGAAATGTCATTAGGGGTCGATTTCACCGACTTATACAAGAACTCAGACTTCTGCAGGAGGAACAAAGCTTTGATTACGGAACTAACAGTGCCACGACCTGCTACCTGCCCGGGCGGCCGCCCGGCCAGGTACTCCTGCCAAGCGTAACCCGGCTTCACCATGTAGCCCTCGATAGACTTCATGGCCTTGGCACGCTGAGCACGCAGCTTACCGCACACAATGACCTGCACACCCTTGGCG


Protein sequences

Name Description Sequence
Pin.7137 translated coding region predicted by ESTScan from UniGene Pin.7137

XRGRGRGTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRVFCYLIKYFESMPGVGKIEEGYNPATWTLEVTSSSPRNVIRGRFHRLIQELRLLQEEQSFDYGTNSATTCYLPGRPPGQVLLPSVTRLHHVALDRLHGLGTLSTQLTAHNDLHTLGX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF10
8-75 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

TIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRVFCYLIKYFESMPGVGKIEEGYNPATWTLEVTSSS

HMMPanther: PTHR19241
8-75 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

TIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRVFCYLIKYFESMPGVGKIEEGYNPATWTLEVTSSS

Seg: seg
89-98 seg

QELRLLQEEQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox