PRGDB00073959 (Pin.8297)

From PRG Wiki
Jump to: navigation, search
Pin.8297
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 239846883 (GR289548)
Gene Class Unknown
Domain Type LRR
Gene Species Phytophthora infestans

Comment?

G969P317RL17.T0 Phytophthora infestans T30-4 NORMALIZED Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

TTTTTTTGACGGAAGGTTAAGCGCACGTTTCATTCGCTTATAGTAACTACGAAAAACTGGAGACGTCTCTCATACTTTTGTCTGCACTGCCGAAAGGTGGAAGGCGCGCTTCCGTGAGACGAGGTGAGAGTTGTTGGCGGGGTCATCTTCTGGAGCTCCGTCGCCCGGTTCATCGCTTCTTCCCTTGTGATCAAAGCTCGGACTCAAGAACGTGGCTGACGAATTGGACGGCGGGTCCTCAAGCGTCTGCAAGAACTGATGCGATGATGTGGGTGGCGTATCTGGCGTGGGCATGGGGTCTCCCAGAATGGCGTGATGGTAGCTCGCTTTACGGTTCTTCCACTTGGTCATAACGGCCTCGAGACTAGAGCAACCGTCCAGGAAGTTGGGCAGCTCGCCACGCAGTCGGTTGTCGCGGAAGTCGGACTCTTTAAGGAATTTAAGCCGCGCGATGCTGCCCGGCACGCGGCCTTCAAGGGCGTTGTCGAACAGGTAGAGATACTCGAGGTCTTCCAGGTCTCCCAATGTCTCGGGAATAGGTCCGCTGAGTTGGTTGCTAGACAGATTGAGGAACTCGAGCGCCTTGCAGCAGCCGATGGACGGCGGGATGACACCTGTCAGCTCATTGTTGCGCAGGGACAGGAAAACCAACGACTGCGAGCGGCCGATCTCTACCGGACGCGGCCCGTGAGGCAGATGCCCCGCACGCTGAACTTGGTGAGCTGTGAAGCTCACACAGAGCGTCGGTAAAGCTCCAC


Protein sequences

Name Description Sequence
Pin.8297 translated coding region predicted by ESTScan from UniGene Pin.8297

XGALPTLCVSFTAHQVQRAGHLPHGPRPVEIGRSQSLVFLSLRNNELTGVIPPSIGCCKALEFLNLSSNQLSGPIPETLGDLEDLEYLYLFDNALEGRVPGSIARLKFLKESDFRDNRLRGELPNFLDGCSSLEAVMTKWKNRKASYHHAILGDPMPTPDTPPTSSHQFLQTLEDPPSNSSATFLSPSFDHKGRSDEPGDGAPEDDPANNSHLVSRKRAFHLSAVQTKV

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
24-134 L domain-like,LRR

HGPRPVEIGRSQSLVFLSLRNNELTGVIPPSIGCCKALEFLNLSSNQLSGPIPETLGDLEDLEYLYLFDNALEGRVPGSIARLKFLKESDFRDNRLRGELPNFLDGCSSLE

HMMPanther: PTHR24420
25-134 FAMILY NOT NAMED,FAMILY NOT NAMED

GPRPVEIGRSQSLVFLSLRNNELTGVIPPSIGCCKALEFLNLSSNQLSGPIPETLGDLEDLEYLYLFDNALEGRVPGSIARLKFLKESDFRDNRLRGELPNFLDGCSSLE

Gene3D: G3DSA:3.80.10.10
27-134 no description

RPVEIGRSQSLVFLSLRNNELTGVIPPSIGCCKALEFLNLSSNQLSGPIPETLGDLEDLEYLYLFDNALEGRVPGSIARLKFLKESDFRDNRLRGELPNFLDGCSSLE

HMMPfam: PF12799
36-72 LRR_4,Leucine Rich repeats (2 copies)

SLVFLSLRNNELTGVIPPSIGCCKALEFLNLSSNQLS

Seg: seg
81-90 seg

DLEDLEYLYL

Seg: seg
154-164 seg

DPMPTPDTPPT

Seg: seg
196-208 seg

DEPGDGAPEDDPA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox