PRGDB00073960 (Pin.8370)

From PRG Wiki
Jump to: navigation, search
Pin.8370
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 239854806 (GR297139)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Phytophthora infestans

Comment?

G969P332FC23.T0 Phytophthora infestans T30-4 NORMALIZED Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

AGTAATTGCAGCCATCGCAATGCAGATACTGACGGGACTCGCCCATCTCAAAAGGGTTCGCCATGTTCATCGCGATATCAAGCCTCAGAACATCCTCGTGCAACAGGACGGAGCTGTGAAACTCACGGATTTTGGACTCGCCCGTGAGCTGAGTTCGTCCACCAGTATGGCTCAAACTTTTGTGGGAACTTTTAAGTACATGGCGCCGGAACGTGTGCAAAACGAACCCTACGACTACAAGTCGGACATTTGGAGTCTCGGTCTCGTACTCATTGAGTGCGCGACACAAACATTCCCATACGCTAACGCCCGGAGCTACATCGACGTGGTCCAGAGTATTGTTGAAAGTCCTGAACCTAGTTTGCCGGAGGTTGACGCTAACGGCGAGTTATTCACTCGTGAGTTTCACGACTTCATCGGTCGATGTCTGAAGAAAGAGCCTTCCGAGCGTGCGTCGGTCGAAGAACTTCTCGACTCGTCATGGCTTCAGCTCCATAACGCGACGAGTACTGAACGTTCGGTTCGACGCTGTGCTACGTGGCTGGAGCAACTTCGTTTCGTGAACGAGGATGCATCCGAAGCAAAAGATTCGCGTCACGAGGAGCAACACGACGCTAAACAGCTCAAGGCGAAGCAGCACGACGAAGAAGAGGAAATCGAAGAAGCCATCGAAGGGAGCGAGCACTGCATGAGCTCACGGCTACTACCGTGCTCAGTTGTCTGACTGATAATAACACTACTGTAATAGCAAAAAAA


Protein sequences

Name Description Sequence
Pin.8370 translated coding region predicted by ESTScan from UniGene Pin.8370

XVIAAIAMQILTGLAHLKRVRHVHRDIKPQNILVQQDGAVKLTDFGLARELSSSTSMAQTFVGTFKYMAPERVQNEPYDYKSDIWSLGLVLIECATQTFPYANARSYIDVVQSIVESPEPSLPEVDANGELFTREFHDFIGRCLKKEPSERASVEELLDSSWLQLHNATSTERSVRRCATWLEQLRFVNEDASEAKDSRHEEQHDAKQLKAKQHDEEEEIEEAIEGSEHCMSSRLLPCSVV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-163 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XVIAAIAMQILTGLAHLKRVRHVHRDIKPQNILVQQDGAVKLTDFGLARELSSSTSMAQTFVGTFKYMAPERVQNEPYDYKSDIWSLGLVLIECATQTFPYANARSYIDVVQSIVESPEPSLPEVDANGELFTREFHDFIGRCLKKEPSERASVEELLDSSWL

HMMSmart: SM00219
IPR020635
1-163 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XVIAAIAMQILTGLAHLKRVRHVHRDIKPQNILVQQDGAVKLTDFGLARELSSSTSMAQTFVGTFKYMAPERVQNEPYDYKSDIWSLGLVLIECATQTFPYANARSYIDVVQSIVESPEPSLPEVDANGELFTREFHDFIGRCLKKEPSERASVEELLDSSWL

HMMPanther: PTHR24362
2-172 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE NEK

VIAAIAMQILTGLAHLKRVRHVHRDIKPQNILVQQDGAVKLTDFGLARELSSSTSMAQTFVGTFKYMAPERVQNEPYDYKSDIWSLGLVLIECATQTFPYANARSYIDVVQSIVESPEPSLPEVDANGELFTREFHDFIGRCLKKEPSERASVEELLDSSWLQLHNATSTE

superfamily: SSF56112
IPR011009
2-194 Protein kinase-like (PK-like)
Protein kinase-like domain

VIAAIAMQILTGLAHLKRVRHVHRDIKPQNILVQQDGAVKLTDFGLARELSSSTSMAQTFVGTFKYMAPERVQNEPYDYKSDIWSLGLVLIECATQTFPYANARSYIDVVQSIVESPEPSLPEVDANGELFTREFHDFIGRCLKKEPSERASVEELLDSSWLQLHNATSTERSVRRCATWLEQLRFVNEDASE

HMMSmart: SM00220
IPR002290
2-163 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

VIAAIAMQILTGLAHLKRVRHVHRDIKPQNILVQQDGAVKLTDFGLARELSSSTSMAQTFVGTFKYMAPERVQNEPYDYKSDIWSLGLVLIECATQTFPYANARSYIDVVQSIVESPEPSLPEVDANGELFTREFHDFIGRCLKKEPSERASVEELLDSSWL

HMMPfam: PF00069
IPR017442
3-163 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

IAAIAMQILTGLAHLKRVRHVHRDIKPQNILVQQDGAVKLTDFGLARELSSSTSMAQTFVGTFKYMAPERVQNEPYDYKSDIWSLGLVLIECATQTFPYANARSYIDVVQSIVESPEPSLPEVDANGELFTREFHDFIGRCLKKEPSERASVEELLDSSWL

Gene3D: G3DSA:1.10.510.10
3-217 no description

IAAIAMQILTGLAHLKRVRHVHRDIKPQNILVQQDGAVKLTDFGLARELSSSTSMAQTFVGTFKYMAPERVQNEPYDYKSDIWSLGLVLIECATQTFPYANARSYIDVVQSIVESPEPSLPEVDANGELFTREFHDFIGRCLKKEPSERASVEELLDSSWLQLHNATSTERSVRRCATWLEQLRFVNEDASEAKDSRHEEQHDAKQLKAKQHDEE

Coil: coil
192-227 coiled-coil

ASEAKDSRHEEQHDAKQLKAKQHDEEEEIEEAIEGS

Seg: seg
216-225 seg

EEEEIEEAIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox