PRGDB00073961 (Pin.8453)

From PRG Wiki
Jump to: navigation, search
Pin.8453
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 239852150 (GR293072)
Gene Class Unknown
Domain Type LRR
Gene Species Phytophthora infestans

Comment?

G969P325FI13.T0 Phytophthora infestans T30-4 NORMALIZED Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

AAATGAATTGGAAGGCTGTTTACCGGAACAATTAGGCAAACTAGACAAATTGCGGGAATTGGGGCTGGAAGGCAACAAATTGACGCAACTACCGGAGTCTATTGGTGGTCTAGTTCATTTGGAGGTGCTCCGGGTCGAGAGCAATCAACTAAAAGCGCTCCCGTCGACAATCGGGAAATTAAGAAACTTGAAGACGTTGACGGCGCACTCGAATCAAATTGCAGCGCTCCCAGCATCATTTAACTCACTTACAGGGCTGCTGACGTTAGATTTGAAGAAGAATTGCTTGGCTACTACTGGTGACGCTTTTCTCGAGCTGACAGCCGTCAAGTACATTGATCTGCGTCAGAACAAGCTGGAAATATTTCCAACGCTGCCCGAGAATAACTCGTGCTTAGATCAGCTCTTCCTGGGGTTCAATTTGCTGCGTGATGTACCCCAAGAAGTTGTGCTGAGTGTTAAAGAGTCCCTGACGGTGCTGGATGTTCGAGACAACAAGCTGCAGCGATTGTCGGATGGAATTCCACAGCTGTACCGCTTGAAGACGCTCGATGTTACAAACAACGACCTGTTTGATTTACCCCCGGGCTTTGGGATATCTCAAGTATCTGACTCACTTGTTGGTTGAGGGAAACCCTCTACGATCCATCCCGCCGATCTATTATCTCGGCTGGAACGGAGCCACTGAAGAAATATCTGCGTACTCGCGGTAACCACCAGTCGGAGTCGATGCCATGGAGAGAGTGGACGAGTTCGGCCATCCGACAGAAGGTGATAGAGCAAGACGAACCTATGGCCGAAGAACC


Protein sequences

Name Description Sequence
Pin.8453 translated coding region predicted by ESTScan from UniGene Pin.8453

XNELEGCLPEQLGKLDKLRELGLEGNKLTQLPESIGGLVHLEVLRVESNQLKALPSTIGKLRNLKTLTAHSNQIAALPASFNSLTGLLTLDLKKNCLATTGDAFLELTAVKYIDLRQNKLEIFPTLPENNSCLDQLFLGFNLLRDVPQEVVLSVKESLTVLDVRDNKLQRLSDGIPQLYRLKTLDVTNNDLFDLPPGFGISQVSDSLVGXRETLYDPSRRSIISAGTEPLKKYLRTRGNHQSESMPWREWTSSAIRQKVIEQDEPMAEEP


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
2-201 L domain-like,LRR

NELEGCLPEQLGKLDKLRELGLEGNKLTQLPESIGGLVHLEVLRVESNQLKALPSTIGKLRNLKTLTAHSNQIAALPASFNSLTGLLTLDLKKNCLATTGDAFLELTAVKYIDLRQNKLEIFPTLPENNSCLDQLFLGFNLLRDVPQEVVLSVKESLTVLDVRDNKLQRLSDGIPQLYRLKTLDVTNNDLFDLPPGFGIS

Gene3D: G3DSA:3.80.10.10
2-196 no description

NELEGCLPEQLGKLDKLRELGLEGNKLTQLPESIGGLVHLEVLRVESNQLKALPSTIGKLRNLKTLTAHSNQIAALPASFNSLTGLLTLDLKKNCLATTGDAFLELTAVKYIDLRQNKLEIFPTLPENNSCLDQLFLGFNLLRDVPQEVVLSVKESLTVLDVRDNKLQRLSDGIPQLYRLKTLDVTNNDLFDLPP

HMMPanther: PTHR23155
3-199 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ELEGCLPEQLGKLDKLRELGLEGNKLTQLPESIGGLVHLEVLRVESNQLKALPSTIGKLRNLKTLTAHSNQIAALPASFNSLTGLLTLDLKKNCLATTGDAFLELTAVKYIDLRQNKLEIFPTLPENNSCLDQLFLGFNLLRDVPQEVVLSVKESLTVLDVRDNKLQRLSDGIPQLYRLKTLDVTNNDLFDLPPGFG

HMMSmart: SM00369
IPR003591
15-37 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LDKLRELGLEGNKLTQLPESIGG

HMMSmart: SM00364
15-34 Leucine-rich repeats, bacterial type

LDKLRELGLEGNKLTQLPES

HMMPfam: PF00560
IPR001611
17-38 LRR_1
Leucine-rich repeat

KLRELGLEGNKLTQLPESIGGL

HMMSmart: SM00364
38-57 Leucine-rich repeats, bacterial type

LVHLEVLRVESNQLKALPST

HMMSmart: SM00369
IPR003591
38-60 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVHLEVLRVESNQLKALPSTIGK

HMMPfam: PF12799
40-79 LRR_4,Leucine Rich repeats (2 copies)

HLEVLRVESNQLKALPSTIGKLRNLKTLTAHSNQIAALPA

HMMSmart: SM00364
61-80 Leucine-rich repeats, bacterial type

LRNLKTLTAHSNQIAALPAS

HMMSmart: SM00369
IPR003591
61-83 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLKTLTAHSNQIAALPASFNS

HMMSmart: SM00364
107-126 Leucine-rich repeats, bacterial type

LTAVKYIDLRQNKLEIFPTL

HMMSmart: SM00369
IPR003591
107-129 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTAVKYIDLRQNKLEIFPTLPEN

HMMSmart: SM00364
155-174 Leucine-rich repeats, bacterial type

KESLTVLDVRDNKLQRLSDG

HMMSmart: SM00369
IPR003591
156-177 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

ESLTVLDVRDNKLQRLSDGIPQ

HMMPfam: PF00560
IPR001611
157-176 LRR_1
Leucine-rich repeat

SLTVLDVRDNKLQRLSDGIP

HMMSmart: SM00364
178-197 Leucine-rich repeats, bacterial type

LYRLKTLDVTNNDLFDLPPG

HMMSmart: SM00369
IPR003591
178-201 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LYRLKTLDVTNNDLFDLPPGFGIS

HMMPfam: PF00560
IPR001611
180-198 LRR_1
Leucine-rich repeat

RLKTLDVTNNDLFDLPPGF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox