PRGDB00073962 (Pin.8561)

From PRG Wiki
Jump to: navigation, search
Pin.8561
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 239854494 (GR296822)
Gene Class Unknown
Domain Type
Gene Species Phytophthora infestans

Comment?

G969P331FL21.T0 Phytophthora infestans T30-4 NORMALIZED Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

ATTGGTGCTGGTATGGACCACTCTGTCGACATGAATGTGAATTTTGTTCAGGAATTTCACGATAGTAGTCTCAAAACCACGTTGAACCGGAACTTGAGTAAGGAAGGCGTGGCTGTGCCGGTGTCGGGCCAAGACGAACTCTCCTTTACCAACAAACGTGCAGCCAGTAACGTGACACAGCTGCACATGGTTACTCAACGTTTCTTCCGGATGTACTGGCGCATACCGACGTATAACTGGACACGTATAGTGGTGTATACTGTCATGGGACTTCTTTTCGGACTGGTATTTGTTGACGCCAACTATACGACGTACCAGGAAGTAAACAGCGGACTCGGGATGATCTTCTGCACCACCGCATTCCTCGGTATCGTATCACTGAATAGCGCTGTGCCAGTGACTTCGGAGCAACGCGCTTCATTCTATCGCGAACGAGCGTCGCAGAGTTACAATTCCTTCTGGTATTTCCTGGGTTTTACGCTCGCTGAGATCCCGTATGTACTCGTATCAAGTCTGATCTTCACTGTAACCTGCTTGCCTCTAGCAGGCTTCACTGACATCGGAGACCTCGCTTTCTACTGGCTAAACCTGACTCTCCACGTACTGTGCCAGATCTACTTAGGTCAACTGCTGTCGTTTGCTATGCCGAGTATGGAGGT


Protein sequences

Name Description Sequence
Pin.8561 translated coding region predicted by ESTScan from UniGene Pin.8561

IGAGMDHSVDMNVNFVQEFHDSSLKTTLNRNLSKEGVAVPVSGQDELSFTNKRAASNVTQLHMVTQRFFRMYWRIPTYNWTRIVVYTVMGLLFGLVFVDANYTTYQEVNSGLGMIFCTTAFLGIVSLNSAVPVTSEQRASFYRERASQSYNSFWYFLGFTLAEIPYVLVSSLIFTVTCLPLAGFTDIGDLAFYWLNLTLHVLCQIYLGQLLSFAMPSMEV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF10
10-220 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

DMNVNFVQEFHDSSLKTTLNRNLSKEGVAVPVSGQDELSFTNKRAASNVTQLHMVTQRFFRMYWRIPTYNWTRIVVYTVMGLLFGLVFVDANYTTYQEVNSGLGMIFCTTAFLGIVSLNSAVPVTSEQRASFYRERASQSYNSFWYFLGFTLAEIPYVLVSSLIFTVTCLPLAGFTDIGDLAFYWLNLTLHVLCQIYLGQLLSFAMPSMEV

HMMPanther: PTHR19241
10-220 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

DMNVNFVQEFHDSSLKTTLNRNLSKEGVAVPVSGQDELSFTNKRAASNVTQLHMVTQRFFRMYWRIPTYNWTRIVVYTVMGLLFGLVFVDANYTTYQEVNSGLGMIFCTTAFLGIVSLNSAVPVTSEQRASFYRERASQSYNSFWYFLGFTLAEIPYVLVSSLIFTVTCLPLAGFTDIGDLAFYWLNLTLHVLCQIYLGQLLSFAMPSMEV

HMMPfam: PF01061
IPR013525
59-219 ABC2_membrane
ABC-2 type transporter

TQLHMVTQRFFRMYWRIPTYNWTRIVVYTVMGLLFGLVFVDANYTTYQEVNSGLGMIFCTTAFLGIVSLNSAVPVTSEQRASFYRERASQSYNSFWYFLGFTLAEIPYVLVSSLIFTVTCLPLAGFTDIGDLAFYWLNLTLHVLCQIYLGQLLSFAMPSME






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox