PRGDB00073963 (Pin.8599)

From PRG Wiki
Jump to: navigation, search
Pin.8599
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 239844905 (GR286145)
Gene Class Unknown
Domain Type
Gene Species Phytophthora infestans

Comment?

G969P38FP11.T0 Phytophthora infestans T30-4 NORMALIZED Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

AACCCCGCCAACTTCAGTCGTATCACGGCGTACTGCGAGCAGATGGACATCCACTCTGAAGCTGCGACGATCTTGGAGGCGCTGGTGTTCTCGGCCAATCTGCGTCTGCCCCCGAACTTCACGAAGGAGCAGCGCATGAACCTGGTGCACGAGACGCTGGACCTGTTGGAGCTTACCTCGATCTCTGGCGCTATGGTCGGTGGCCTGTCGGTGGAGCAGAAGAAGCGTGTGACCATCGGTGTCGAGGTGGTGGCCAACCCCAGTATCTTGTTCCTGGACGAGCCCACCAGTGGTCTGGACGCGCGTTCGGCTCTGATCGTCATGCGCGGTGTGCAGTCGATCGCCCGTACGGGTCGTACCGTGCTGTGTACCATCCACCAGCCTAGTATCTCGATCTTTGAGCTGTTCGACGGTCTGCTGCTGCTCCAGCGCGGTGGCTTCACTGCGTACTTTGGTGACCTTGGTGTGGACTCTGTCAAGATGCTCGAGTACTTCGCGTCGATCCCTGGCACGATGGAGATCCGTCCGCAGTACAACCCGGCCACGTACATGCTTGAAGTGATTGGCGCGGGTATCGGCCGTGACGTGAAGGACTACTCGATCGAGTACAAGAACAGCGAGCTGTACAAGTCGAACCGCGAGCGCACGCTCCTGTTGGCTGAAGTTTCCAGCGACTTTGTGTGCCACTCGACTCTGAACTAACACGCCTATTGCCACGGGCTCTTGAACCAGTTGAAGGAGCTCGCCGTTAAGCAGCAGCTCACGTACTGGCTG


Protein sequences

Name Description Sequence
Pin.8599 translated coding region predicted by ESTScan from UniGene Pin.8599

NPANFSRITAYCEQMDIHSEAATILEALVFSANLRLPPNFTKEQRMNLVHETLDLLELTSISGAMVGGLSVEQKKRVTIGVEVVANPSILFLDEPTSGLDARSALIVMRGVQSIARTGRTVLCTIHQPSISIFELFDGLLLLQRGGFTAYFGDLGVDSVKMLEYFASIPGTMEIRPQYNPATYMLEVIGAGIGRDVKDYSIEYKNSELYKSNRERTLLLAEVSSDFVCHSTLNXHAYCHGLLNQLKELAVKQQLTYWL

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-152 P-loop containing nucleoside triphosphate hydrolases

NPANFSRITAYCEQMDIHSEAATILEALVFSANLRLPPNFTKEQRMNLVHETLDLLELTSISGAMVGGLSVEQKKRVTIGVEVVANPSILFLDEPTSGLDARSALIVMRGVQSIARTGRTVLCTIHQPSISIFELFDGLLLLQRGGFTAYFG

HMMPanther: PTHR19241:SF10
5-257 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

FSRITAYCEQMDIHSEAATILEALVFSANLRLPPNFTKEQRMNLVHETLDLLELTSISGAMVGGLSVEQKKRVTIGVEVVANPSILFLDEPTSGLDARSALIVMRGVQSIARTGRTVLCTIHQPSISIFELFDGLLLLQRGGFTAYFGDLGVDSVKMLEYFASIPGTMEIRPQYNPATYMLEVIGAGIGRDVKDYSIEYKNSELYKSNRERTLLLAEVSSDFVCHSTLNXHAYCHGLLNQLKELAVKQQLTYW

HMMPanther: PTHR19241
5-257 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

FSRITAYCEQMDIHSEAATILEALVFSANLRLPPNFTKEQRMNLVHETLDLLELTSISGAMVGGLSVEQKKRVTIGVEVVANPSILFLDEPTSGLDARSALIVMRGVQSIARTGRTVLCTIHQPSISIFELFDGLLLLQRGGFTAYFGDLGVDSVKMLEYFASIPGTMEIRPQYNPATYMLEVIGAGIGRDVKDYSIEYKNSELYKSNRERTLLLAEVSSDFVCHSTLNXHAYCHGLLNQLKELAVKQQLTYW

Gene3D: G3DSA:3.40.50.300
5-149 no description

FSRITAYCEQMDIHSEAATILEALVFSANLRLPPNFTKEQRMNLVHETLDLLELTSISGAMVGGLSVEQKKRVTIGVEVVANPSILFLDEPTSGLDARSALIVMRGVQSIARTGRTVLCTIHQPSISIFELFDGLLLLQRGGFTA

HMMPfam: PF00005
IPR003439
36-97 ABC_tran
ABC transporter-like

LPPNFTKEQRMNLVHETLDLLELTSISGAMVGGLSVEQKKRVTIGVEVVANPSILFLDEPTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox