PRGDB00073964 (Pin.8740)

From PRG Wiki
Jump to: navigation, search
Pin.8740
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 239843389 (GR285917)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Phytophthora infestans

Comment?

G969P38FJ11.T0 Phytophthora infestans T30-4 NORMALIZED Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

TTTATGGCTGGTGGGGATCTGCGTACCCTTCTGAAGGAATATCACGCCAGTGGCATACCTCAAGGCATGGACGCCAGCAAAACGCAAATTGCATACGGAGTGGCGCACGCACTGACATATTTGCACTCGCTCGAGCCTGTAGTTTTGCATCGAGATCTCAAATCGCGAAATATTTTATTGACGGAGTCGCTGTCTGCCAAGATCACGGACTTTGGTGCGTCACGAGCTCGATCGGATGCAACAATGACCTCGAATGTGGGGAGTTCGCTGTGGATGGCGCCGGAGGTTATGATGGGCGAGAGATACGACGAGAAGGCTGACATCTTCTCTCTTGGTGTGGTCATTTCGGAGCTGGACACACAGGAACTGCCGTACGCACATGCTAAGGAAGGCAATAGCAGGACGGGATACCCACTTTCGGATACGGCTGTGCTGCAGATGGTGTCGATGGGCAAACTACGCGTCCATCTGTCGCCGGCGATGCATCCGGATATGGGTTCAGTCTGTCTACCGATGCGTGAGTGTGGATCCACAGGGAACGTCCTACTGCTGCTGAGGTGCTCTATTACTTCCAGGTGATGACTCGAAACCGGCAATTTTAATCTTTTGAGACCCTTAGCATGAGTCaaaaaaaaaa


Protein sequences

Name Description Sequence
Pin.8740 translated coding region predicted by ESTScan from UniGene Pin.8740

FMAGGDLRTLLKEYHASGIPQGMDASKTQIAYGVAHALTYLHSLEPVVLHRDLKSRNILLTESLSAKITDFGASRARSDATMTSNVGSSLWMAPEVMMGERYDEKADIFSLGVVISELDTQELPYAHAKEGNSRTGYPLSDTAVLQMVSMGKLRVHLSPAMHPDMGSVCLPMRECGSTGNVLLLLRCSITSR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-192 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FMAGGDLRTLLKEYHASGIPQGMDASKTQIAYGVAHALTYLHSLEPVVLHRDLKSRNILLTESLSAKITDFGASRARSDATMTSNVGSSLWMAPEVMMGERYDEKADIFSLGVVISELDTQELPYAHAKEGNSRTGYPLSDTAVLQMVSMGKLRVHLSPAMHPDMGSVCLPMRECGSTGNVLLLLRCSITSR

Gene3D: G3DSA:1.10.510.10
1-129 no description

FMAGGDLRTLLKEYHASGIPQGMDASKTQIAYGVAHALTYLHSLEPVVLHRDLKSRNILLTESLSAKITDFGASRARSDATMTSNVGSSLWMAPEVMMGERYDEKADIFSLGVVISELDTQELPYAHAK

superfamily: SSF56112
IPR011009
1-170 Protein kinase-like (PK-like)
Protein kinase-like domain

FMAGGDLRTLLKEYHASGIPQGMDASKTQIAYGVAHALTYLHSLEPVVLHRDLKSRNILLTESLSAKITDFGASRARSDATMTSNVGSSLWMAPEVMMGERYDEKADIFSLGVVISELDTQELPYAHAKEGNSRTGYPLSDTAVLQMVSMGKLRVHLSPAMHPDMGSVCL

HMMPanther: PTHR23257
1-165 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

FMAGGDLRTLLKEYHASGIPQGMDASKTQIAYGVAHALTYLHSLEPVVLHRDLKSRNILLTESLSAKITDFGASRARSDATMTSNVGSSLWMAPEVMMGERYDEKADIFSLGVVISELDTQELPYAHAKEGNSRTGYPLSDTAVLQMVSMGKLRVHLSPAMHPDM

HMMSmart: SM00219
IPR020635
1-184 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FMAGGDLRTLLKEYHASGIPQGMDASKTQIAYGVAHALTYLHSLEPVVLHRDLKSRNILLTESLSAKITDFGASRARSDATMTSNVGSSLWMAPEVMMGERYDEKADIFSLGVVISELDTQELPYAHAKEGNSRTGYPLSDTAVLQMVSMGKLRVHLSPAMHPDMGSVCLPMRECGSTGNVLLL

HMMSmart: SM00220
IPR002290
1-165 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FMAGGDLRTLLKEYHASGIPQGMDASKTQIAYGVAHALTYLHSLEPVVLHRDLKSRNILLTESLSAKITDFGASRARSDATMTSNVGSSLWMAPEVMMGERYDEKADIFSLGVVISELDTQELPYAHAKEGNSRTGYPLSDTAVLQMVSMGKLRVHLSPAMHPDM

HMMPfam: PF00069
IPR017442
2-134 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

MAGGDLRTLLKEYHASGIPQGMDASKTQIAYGVAHALTYLHSLEPVVLHRDLKSRNILLTESLSAKITDFGASRARSDATMTSNVGSSLWMAPEVMMGERYDEKADIFSLGVVISELDTQELPYAHAKEGNSR

PatternScan: PS00108
IPR008271
48-60 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDLKSRNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox