PRGDB00073965 (Pin.8821)

From PRG Wiki
Jump to: navigation, search
Pin.8821
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 239851751 (GR292791)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Phytophthora infestans

Comment?

G969P325FB13.T0 Phytophthora infestans T30-4 NORMALIZED Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

CACAATTTGCGGCTCGGAGATCTTCCGATACTCTTGTCTGTACGTCGGTCGACGCGGTGCTGTGCGGTTGGTACGAGGCACCGACATGGCTCGGTTTGCCAGTCGACCGGTAGTCGCGAGGTCGTCCAGTGCGAGCTCCAGATTGCGCAACTCGAAGTGCAGCTGCAAGGCCGACGGTCGATTCATCGGGTCGGCGTCCAGACACTTGGCCACCAGGTCCTTCACACTGTTCGGACAGTCCGGGCTCAGCGACGGCCTCAATTTGCCTGCACTAACTAATACAGCGATCCGGGCGTTCGTGTGCTTGATGTTCCCGCCTCGGTTGTCCTCGGTAGGGACGCCCTCGGAATACGGTCGACGACACGTGTCCAATTCGGTCATGATGACGCCAAAGGAATACATATCCGCCTTCTCGGAATACCGCTCTCCACGCAGAACTTCGGGTGCAATCCAAGAGATGGTACCGATCTCCGCAGTCATCGTCCGATCCTCGGTGAGTTCCCGACTCACGCCAAAGTCCGTGAGTTTCGCCTCCCATTTCTCGCTCATCAGCACGTTGTTCGGCTTGAGATCTCGATGGATCATGGGGCTCTCAAGGAGTGTAGATAGACCAGAGCTTCGGCGATATCTAGAGCCACAAGAGACTTGCACTTGACGCCTCCTCGCTCGGACTTTGTGGACCGGAACCAGCCGTACGAGCCACGTGCAGACGGATCGCGCGTCTCACGCTTCAGTTGCTTCTGCAGGAGCGTGGCGGAGAATCCTCCGGTTTGGCATGTGCCTCGAACAC


Protein sequences

Name Description Sequence
Pin.8821 translated coding region predicted by ESTScan from UniGene Pin.8821

XVRGTCQTGGFSATLLQKQLKRETRDPSARGSYGWFRSTKSERGGVKCKSLVALDIAEAXGLSTLLESPMIHRDLKPNNVLMSEKWEAKLTDFGVSRELTEDRTMTAEIGTISWIAPEVLRGERYSEKADMYSFGVIMTELDTCRRPYSEGVPTEDNRGGNIKHTNARIAVLVSAGKLRPSLSPDCPNSVKDLVAKCLDADPMNRPSALQLHFELRNLELALDDLATTGRLANRAMSVPRTNRTAPRRPTYRQEYRKISEPQIV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-215 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XVRGTCQTGGFSATLLQKQLKRETRDPSARGSYGWFRSTKSERGGVKCKSLVALDIAEAXGLSTLLESPMIHRDLKPNNVLMSEKWEAKLTDFGVSRELTEDRTMTAEIGTISWIAPEVLRGERYSEKADMYSFGVIMTELDTCRRPYSEGVPTEDNRGGNIKHTNARIAVLVSAGKLRPSLSPDCPNSVKDLVAKCLDADPMNRPSALQLHFEL

HMMSmart: SM00219
IPR020635
1-215 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XVRGTCQTGGFSATLLQKQLKRETRDPSARGSYGWFRSTKSERGGVKCKSLVALDIAEAXGLSTLLESPMIHRDLKPNNVLMSEKWEAKLTDFGVSRELTEDRTMTAEIGTISWIAPEVLRGERYSEKADMYSFGVIMTELDTCRRPYSEGVPTEDNRGGNIKHTNARIAVLVSAGKLRPSLSPDCPNSVKDLVAKCLDADPMNRPSALQLHFEL

HMMSmart: SM00220
IPR002290
11-221 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSATLLQKQLKRETRDPSARGSYGWFRSTKSERGGVKCKSLVALDIAEAXGLSTLLESPMIHRDLKPNNVLMSEKWEAKLTDFGVSRELTEDRTMTAEIGTISWIAPEVLRGERYSEKADMYSFGVIMTELDTCRRPYSEGVPTEDNRGGNIKHTNARIAVLVSAGKLRPSLSPDCPNSVKDLVAKCLDADPMNRPSALQLHFELRNLELA

HMMPanther: PTHR23257
53-249 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

ALDIAEAXGLSTLLESPMIHRDLKPNNVLMSEKWEAKLTDFGVSRELTEDRTMTAEIGTISWIAPEVLRGERYSEKADMYSFGVIMTELDTCRRPYSEGVPTEDNRGGNIKHTNARIAVLVSAGKLRPSLSPDCPNSVKDLVAKCLDADPMNRPSALQLHFELRNLELALDDLATTGRLANRAMSVPRTNRTAPRRP

superfamily: SSF56112
IPR011009
59-213 Protein kinase-like (PK-like)
Protein kinase-like domain

AXGLSTLLESPMIHRDLKPNNVLMSEKWEAKLTDFGVSRELTEDRTMTAEIGTISWIAPEVLRGERYSEKADMYSFGVIMTELDTCRRPYSEGVPTEDNRGGNIKHTNARIAVLVSAGKLRPSLSPDCPNSVKDLVAKCLDADPMNRPSALQLHF

Gene3D: G3DSA:1.10.510.10
59-212 no description

AXGLSTLLESPMIHRDLKPNNVLMSEKWEAKLTDFGVSRELTEDRTMTAEIGTISWIAPEVLRGERYSEKADMYSFGVIMTELDTCRRPYSEGVPTEDNRGGNIKHTNARIAVLVSAGKLRPSLSPDCPNSVKDLVAKCLDADPMNRPSALQLH

HMMPfam: PF00069
IPR017442
60-211 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

XGLSTLLESPMIHRDLKPNNVLMSEKWEAKLTDFGVSRELTEDRTMTAEIGTISWIAPEVLRGERYSEKADMYSFGVIMTELDTCRRPYSEGVPTEDNRGGNIKHTNARIAVLVSAGKLRPSLSPDCPNSVKDLVAKCLDADPMNRPSALQL

PatternScan: PS00108
IPR008271
70-82 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

MIHRDLKPNNVLM

Seg: seg
239-252 seg

PRTNRTAPRRPTYR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox