PRGDB00073966 (Pin.8960)

From PRG Wiki
Jump to: navigation, search
Pin.8960
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 239843488 (GR286016)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Phytophthora infestans

Comment?

G969P38FL19.T0 Phytophthora infestans T30-4 NORMALIZED Phytophthora infestans cDNA, mRNA sequence

DNA Sequence

CTCGGAGCAGGCACGTTTTCCGTCGTAAGGGAAGCTACGCATAAGACCACAGGCGAACGCTTCGCTATCAAGTGCATTAAGCGGGCGCAATTGTCAGCGGATGACCTCGAGGCGCTTGTGGCCGAAGTCAAGATATTGCGGGAGATGCAACACCCGCACATTGTCAAGCTCTACGACGTTTTCCAAGAGGAAAAATACTTTTTCCTAGTCACTGAGTACATGCCAGGTGGCGAGCTGTTTGAGCGGATCGTCAAGAAGAACTTTTACTCCGAAAGAGAAGCCAGAGATCTGGTCAAAGTTCTTCTACAAACCATCGCCTTCTGCCACGATGCAGACGTCGTCCATCGAGACTTAAAACCCGAAAACCTGCTACTAAGCAGCGCCGAGGATGACGCAGACATTAAACTCGCGGACTTTGGATTCGCTAAAAAGGCGATTCAGAACGGAGATGCCGGTCTGTCGACAGCGTGTGGCACGCCTGGATATGTGGCGCCTGAGATCTTGATGTCTAAGCCATACGGCAAGGAAGTGGACATCTGGAGTATCGGAGTCATTACCTACATTCTTTTGTGTGGGTATCCTCCGTTCCACCACGATAACCAGGGCGTCTTGTTCAGACTCATTAAGGCTGGCCGGTACGAGTTTGACTCGCCCTACTGGGACGATGTGTCTGTTGAGCCAAGATCTCATCAGTAAGAATGCTGATCTTGAGCCCGTCGAGCGTGACGGCACGTCAACTGCTCGAACATCGTGGATCGCTGGAGAACGCCGGGTTAAGGACGTGGCAACTGACCACTG


Protein sequences

Name Description Sequence
Pin.8960 translated coding region predicted by ESTScan from UniGene Pin.8960

LGAGTFSVVREATHKTTGERFAIKCIKRAQLSADDLEALVAEVKILREMQHPHIVKLYDVFQEEKYFFLVTEYMPGGELFERIVKKNFYSEREARDLVKVLLQTIAFCHDADVVHRDLKPENLLLSSAEDDADIKLADFGFAKKAIQNGDAGLSTACGTPGYVAPEILMSKPYGKEVDIWSIGVITYILLCGYPPFHHDNQGVLFRLIKAGRYEFDSPYWDDVSVEPRSHQKNADLEPVERDGTSTARTSWIAGERRVKDVATDHX

Domains

Domain Start-End Description Sequence

HMMPfam: PF00069
IPR017442
1-224 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LGAGTFSVVREATHKTTGERFAIKCIKRAQLSADDLEALVAEVKILREMQHPHIVKLYDVFQEEKYFFLVTEYMPGGELFERIVKKNFYSEREARDLVKVLLQTIAFCHDADVVHRDLKPENLLLSSAEDDADIKLADFGFAKKAIQNGDAGLSTACGTPGYVAPEILMSKPYGKEVDIWSIGVITYILLCGYPPFHHDNQGVLFRLIKAGRYEFDSPYWDDVS

ProfileScan: PS50011
IPR000719
1-266 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LGAGTFSVVREATHKTTGERFAIKCIKRAQLSADDLEALVAEVKILREMQHPHIVKLYDVFQEEKYFFLVTEYMPGGELFERIVKKNFYSEREARDLVKVLLQTIAFCHDADVVHRDLKPENLLLSSAEDDADIKLADFGFAKKAIQNGDAGLSTACGTPGYVAPEILMSKPYGKEVDIWSIGVITYILLCGYPPFHHDNQGVLFRLIKAGRYEFDSPYWDDVSVEPRSHQKNADLEPVERDGTSTARTSWIAGERRVKDVATDHX

superfamily: SSF56112
IPR011009
1-226 Protein kinase-like (PK-like)
Protein kinase-like domain

LGAGTFSVVREATHKTTGERFAIKCIKRAQLSADDLEALVAEVKILREMQHPHIVKLYDVFQEEKYFFLVTEYMPGGELFERIVKKNFYSEREARDLVKVLLQTIAFCHDADVVHRDLKPENLLLSSAEDDADIKLADFGFAKKAIQNGDAGLSTACGTPGYVAPEILMSKPYGKEVDIWSIGVITYILLCGYPPFHHDNQGVLFRLIKAGRYEFDSPYWDDVSVE

HMMPanther: PTHR24347
IPR020636
1-226 FAMILY NOT NAMED
Calcium/calmodulin-dependent protein kinase-like

LGAGTFSVVREATHKTTGERFAIKCIKRAQLSADDLEALVAEVKILREMQHPHIVKLYDVFQEEKYFFLVTEYMPGGELFERIVKKNFYSEREARDLVKVLLQTIAFCHDADVVHRDLKPENLLLSSAEDDADIKLADFGFAKKAIQNGDAGLSTACGTPGYVAPEILMSKPYGKEVDIWSIGVITYILLCGYPPFHHDNQGVLFRLIKAGRYEFDSPYWDDVSVE

PatternScan: PS00107
IPR017441
1-24 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGTFSVVREATHKTTGERFAIK

Gene3D: G3DSA:3.30.200.20
1-89 no description

LGAGTFSVVREATHKTTGERFAIKCIKRAQLSADDLEALVAEVKILREMQHPHIVKLYDVFQEEKYFFLVTEYMPGGELFERIVKKNFY

HMMSmart: SM00220
IPR002290
1-252 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LGAGTFSVVREATHKTTGERFAIKCIKRAQLSADDLEALVAEVKILREMQHPHIVKLYDVFQEEKYFFLVTEYMPGGELFERIVKKNFYSEREARDLVKVLLQTIAFCHDADVVHRDLKPENLLLSSAEDDADIKLADFGFAKKAIQNGDAGLSTACGTPGYVAPEILMSKPYGKEVDIWSIGVITYILLCGYPPFHHDNQGVLFRLIKAGRYEFDSPYWDDVSVEPRSHQKNADLEPVERDGTSTARTSWI

HMMSmart: SM00219
IPR020635
1-236 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LGAGTFSVVREATHKTTGERFAIKCIKRAQLSADDLEALVAEVKILREMQHPHIVKLYDVFQEEKYFFLVTEYMPGGELFERIVKKNFYSEREARDLVKVLLQTIAFCHDADVVHRDLKPENLLLSSAEDDADIKLADFGFAKKAIQNGDAGLSTACGTPGYVAPEILMSKPYGKEVDIWSIGVITYILLCGYPPFHHDNQGVLFRLIKAGRYEFDSPYWDDVSVEPRSHQKNADL

Gene3D: G3DSA:1.10.510.10
90-226 no description

SEREARDLVKVLLQTIAFCHDADVVHRDLKPENLLLSSAEDDADIKLADFGFAKKAIQNGDAGLSTACGTPGYVAPEILMSKPYGKEVDIWSIGVITYILLCGYPPFHHDNQGVLFRLIKAGRYEFDSPYWDDVSVE

PatternScan: PS00108
IPR008271
113-125 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDLKPENLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox