PRGDB00073967 (Ppa.23)

From PRG Wiki
Jump to: navigation, search
Ppa.23
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22759867 (AB051839)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Physcomitrella patens

Comment?

Physcomitrella patens PpC10 mRNA, partial cds

DNA Sequence

CTAATGTAAAAGACATGTACAATGCCTCATGCTTTGTTGAGTGCATTGAAAGTGGTGGTGATTGCTATACAACTTCTTGCAATATTTTGGAACAATTTAAAGTCAAATCAAAACCAAAGGATATAAAAGAAGCTCAAAAAATGTTGAAATCATTCTTAGAAGAGAACAAAACTATCTTGGTCTTTGATGATGTGAAGAATCAAAATCAAATTGAAGATGTTGTGCCTATGGATGACATATTTGCAAACAATGGTAGTACATTGATTGCAACAACTCGAGATTCAAAAGCAATGAAGCATTGTGGTAAAGAAGTTTATAAAATGAATGTTGAAGAACTTGGTGAAGGAGCAAGTATGAAGTTGTTTATTACATATTCTTGTGGCCAAGAAAATCTCCCCAATGAACTTAACGAGATTGCCAAAAAAATTGTAAGAGCTTGCAATGGCCTACCATTGAGTTTGAAAGTTATGGGAGCATTTTTAAAAGAGAATAAGAGATTAAGATGTTGGGAGCGAGCTTTACAAAAGTTAAAAAAGGGAAGAGAGTTGGATGGAGATGAAGACAATAGTAACTACAAGATTTGGAAGATATTAAGAGTGAGCTTTGAGAATTTTAAAGTTAAAGAAAAGAGTATGTTTTTGGACATATGTTG


Protein sequences

Name Description Sequence
Ppa.23 translated coding region predicted by ESTScan from UniGene Ppa.23

XNVKDMYNASCFVECIESGGDCYTTSCNILEQFKVKSKPKDIKEAQKMLKSFLEENKTILVFDDVKNQNQIEDVVPMDDIFANNGSTLIATTRDSKAMKHCGKEVYKMNVEELGEGASMKLFITYSCGQENLPNELNEIAKKIVRACNGLPLSLKVMGAFLKENKRLRCWERALQKLKKGRELDGDEDNSNYKIWKILRVSFENFKVKEKSMFLDICX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
7-216 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

YNASCFVECIESGGDCYTTSCNILEQFKVKSKPKDIKEAQKMLKSFLEENKTILVFDDVKNQNQIEDVVPMDDIFANNGSTLIATTRDSKAMKHCGKEVYKMNVEELGEGASMKLFITYSCGQENLPNELNEIAKKIVRACNGLPLSLKVMGAFLKENKRLRCWERALQKLKKGRELDGDEDNSNYKIWKILRVSFENFKVKEKSMFLDI

HMMPanther: PTHR11017
7-216 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YNASCFVECIESGGDCYTTSCNILEQFKVKSKPKDIKEAQKMLKSFLEENKTILVFDDVKNQNQIEDVVPMDDIFANNGSTLIATTRDSKAMKHCGKEVYKMNVEELGEGASMKLFITYSCGQENLPNELNEIAKKIVRACNGLPLSLKVMGAFLKENKRLRCWERALQKLKKGRELDGDEDNSNYKIWKILRVSFENFKVKEKSMFLDI

HMMPfam: PF00931
IPR002182
7-216 NB-ARC,NBS
NB-ARC

YNASCFVECIESGGDCYTTSCNILEQFKVKSKPKDIKEAQKMLKSFLEENKTILVFDDVKNQNQIEDVVPMDDIFANNGSTLIATTRDSKAMKHCGKEVYKMNVEELGEGASMKLFITYSCGQENLPNELNEIAKKIVRACNGLPLSLKVMGAFLKENKRLRCWERALQKLKKGRELDGDEDNSNYKIWKILRVSFENFKVKEKSMFLDI

superfamily: SSF52540
28-177 P-loop containing nucleoside triphosphate hydrolases

NILEQFKVKSKPKDIKEAQKMLKSFLEENKTILVFDDVKNQNQIEDVVPMDDIFANNGSTLIATTRDSKAMKHCGKEVYKMNVEELGEGASMKLFITYSCGQENLPNELNEIAKKIVRACNGLPLSLKVMGAFLKENKRLRCWERALQKL

FPrintScan: PR00364
IPR000767
52-66 DISEASERSIST
Disease resistance protein

FLEENKTILVFDDVK

FPrintScan: PR00364
IPR000767
147-161 DISEASERSIST
Disease resistance protein

CNGLPLSLKVMGAFL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox