PRGDB00073968 (Ppa.117)

From PRG Wiki
Jump to: navigation, search
Ppa.117
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 168050560 (XM_001777675)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Physcomitrella patens

Comment?

Physcomitrella patens subsp. patens predicted protein (PHYPADRAFT_3355) mRNA, partial cds

DNA Sequence

TTGCCTACATTTGAGTTCAGCGACCTGATGATCGCCACAGATAACTTCTCGACCAGCCATTGTCTTCAGAAAGGTGCATTTGGTGCTGTGTACAGCGTTAGACTCAACGATTCCACTACCGGGAACAATGAGGAAGTCGGAATGGCAGTACTTCGACTACCTGAAAGTTTCGTGCAGGGCCCCGTGGAATGGAAGGCTCAGATTCAGCTGCTCTTGCAGCTATCAAACCCCAATGTATGTGCCCTCAAGGGATACTGCAAACACGATGAAGAGTCCAGCGTGAGCATTCGCGAAAGACTGCAAGAACGACTTCTGGTATTCGAGCAACCCCCCAATGGCAGCTTGTACGACCACTTGTTCGGAAGTCGATGCACGACTTACTTGGACTGGGACGCGAGGATCAACATCGCACTTGGTGCAGCTCTTGGGCTGTTGTACATACATGATCGTGCTCCTCTGCAGATTTTGTACAAAGAATTCAAAGCATCTAATGTTTTGCTGGATCAGAATTACACGCCGAAGTTGGCTGGGTATGGCCTGTCTGTCGCTGCTGCACCTATCAGCAAAAATTATTCTTTCACCATGGTAAGAAGCTTAGGCATGATGCTAAGCCAAACGCACGCAAGGAACAACGTATGGAGCTTTGGGATACTCCTCCTTGAGCTTCTCACCGGCAAGAATAGCCAAGATGCTGTGTACTTCGGCGATGACAAAAACTTTTTGCAGTGGGGAAGGAAGTTCATCAAGGAAGAATCTAAACTGTCTCACATCATTGACCCGCGCATGAAAGGAGTGTACCCCATTAAGGGTGTTGTGGAGGTGGTTAATTTGCTGCTTCAATGTGCAAATAAGAAGGATGTGCTGCGGCCAAGTATGTCAGAGGTCTCTGGAACACTGAAG


Protein sequences

Name Description Sequence
Ppa.117 translated coding region predicted by ESTScan from UniGene Ppa.117

LPTFEFSDLMIATDNFSTSHCLQKGAFGAVYSVRLNDSTTGNNEEVGMAVLRLPESFVQGPVEWKAQIQLLLQLSNPNVCALKGYCKHDEESSVSIRERLQERLLVFEQPPNGSLYDHLFGSRCTTYLDWDARINIALGAALGLLYIHDRAPLQILYKEFKASNVLLDQNYTPKLAGYGLSVAAAPISKNYSFTMVRSLGMMLSQTHARNNVWSFGILLLELLTGKNSQDAVYFGDDKNFLQWGRKFIKEESKLSHIIDPRMKGVYPIKGVVEVVNLLLQCANKKDVLRPSMSEVSGTLK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-295 PTHR24420,FAMILY NOT NAMED

LPTFEFSDLMIATDNFSTSHCLQKGAFGAVYSVRLNDSTTGNNEEVGMAVLRLPESFVQGPVEWKAQIQLLLQLSNPNVCALKGYCKHDEESSVSIRERLQERLLVFEQPPNGSLYDHLFGSRCTTYLDWDARINIALGAALGLLYIHDRAPLQILYKEFKASNVLLDQNYTPKLAGYGLSVAAAPISKNYSFTMVRSLGMMLSQTHARNNVWSFGILLLELLTGKNSQDAVYFGDDKNFLQWGRKFIKEESKLSHIIDPRMKGVYPIKGVVEVVNLLLQCANKKDVLRPSMSEV

Gene3D: G3DSA:3.30.200.20
3-77 G3DSA:3.30.200.20

TFEFSDLMIATDNFSTSHCLQKGAFGAVYSVRLNDSTTGNNEEVGMAVLRLPESFVQGPVEWKAQIQLLLQLSNP

superfamily: SSF56112
IPR011009
5-299 Kinase_like
Protein kinase-like domain

EFSDLMIATDNFSTSHCLQKGAFGAVYSVRLNDSTTGNNEEVGMAVLRLPESFVQGPVEWKAQIQLLLQLSNPNVCALKGYCKHDEESSVSIRERLQERLLVFEQPPNGSLYDHLFGSRCTTYLDWDARINIALGAALGLLYIHDRAPLQILYKEFKASNVLLDQNYTPKLAGYGLSVAAAPISKNYSFTMVRSLGMMLSQTHARNNVWSFGILLLELLTGKNSQDAVYFGDDKNFLQWGRKFIKEESKLSHIIDPRMKGVYPIKGVVEVVNLLLQCANKKDVLRPSMSEVSGTL

ProfileScan: PS50011
IPR000719
16-300 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSTSHCLQKGAFGAVYSVRLNDSTTGNNEEVGMAVLRLPESFVQGPVEWKAQIQLLLQLSNPNVCALKGYCKHDEESSVSIRERLQERLLVFEQPPNGSLYDHLFGSRCTTYLDWDARINIALGAALGLLYIHDRAPLQILYKEFKASNVLLDQNYTPKLAGYGLSVAAAPISKNYSFTMVRSLGMMLSQTHARNNVWSFGILLLELLTGKNSQDAVYFGDDKNFLQWGRKFIKEESKLSHIIDPRMKGVYPIKGVVEVVNLLLQCANKKDVLRPSMSEVSGTLK

HMMPfam: PF00069
IPR017442
18-295 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

TSHCLQKGAFGAVYSVRLNDSTTGNNEEVGMAVLRLPESFVQGPVEWKAQIQLLLQLSNPNVCALKGYCKHDEESSVSIRERLQERLLVFEQPPNGSLYDHLFGSRCTTYLDWDARINIALGAALGLLYIHDRAPLQILYKEFKASNVLLDQNYTPKLAGYGLSVAAAPISKNYSFTMVRSLGMMLSQTHARNNVWSFGILLLELLTGKNSQDAVYFGDDKNFLQWGRKFIKEESKLSHIIDPRMKGVYPIKGVVEVVNLLLQCANKKDVLRPSMSEV

Gene3D: G3DSA:1.10.510.10
78-296 G3DSA:1.10.510.10

NVCALKGYCKHDEESSVSIRERLQERLLVFEQPPNGSLYDHLFGSRCTTYLDWDARINIALGAALGLLYIHDRAPLQILYKEFKASNVLLDQNYTPKLAGYGLSVAAAPISKNYSFTMVRSLGMMLSQTHARNNVWSFGILLLELLTGKNSQDAVYFGDDKNFLQWGRKFIKEESKLSHIIDPRMKGVYPIKGVVEVVNLLLQCANKKDVLRPSMSEVS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox