PRGDB00073972 (Ppa.130)

From PRG Wiki
Jump to: navigation, search
Ppa.130
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 33591207 (AY339067)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Physcomitrella patens

Comment?

Physcomitrella patens shaggy-related protein kinase 3 (SK3) mRNA, complete cds

DNA Sequence

AGTTAGTTAGTGCCTGCCTCGCCCTTTCCTCACACTCCGAGTCCATCTGCTGTTTCCCTACCTCCCGATTTCCTGCCCAGGCATGCCTCGGCCGGGCGTAGTGAATAAAGGCACGGCAGAGAGAGAGGATTGGTGCGGAGTGGTCGGGTGTGAGTGATTTGCAAGCCAAGGGGTAGGTAGCTGAGATGGAGATGAGTGGAGCATGTGAGGAGGGAGGATTGGGAAAGCAGGTGGTGATTGTATCATCTTCGCGAGGCATGTGATGTGTGGTCGGTGGAGTTAGCTTCTACGGGCAACTGGAAATCCAGGGAATTCTGCCAGAATTATACGTACTAAAGTAGAAATTTACGTTTCGGGGACTTCGAGTCTTCTATGGCATCTGCGACTGCGGGTATTATCAACAGCACAAACATGATCGGAGGAGGAATAGCTCCAACTAAAGCTGGCTCAAGCGGAGTAGAATTGTTACCGAAAGAAATGCACGACATGAAGCTCAGGGATGACAAGGTTGACCACAGCGACGACAAGGAAATTGAGGCTTCAATAGTAGATGGAAACGGTACCGAAACTGGCCACATCATAGCTACTACTATTGGAGGGCGAAATGGACAACCTAAGCAGACGATCAGCTATTCGGCAGAACGTGTTGTTGGCACTGGATCATTCGGGATTGTCTTCCAGGCAAAATGCATCGAAACTGGGGAGACGGTGGCTATAAAGAAAGTGTTGCAGGACAAAAGATACAAGAATCGAGAGCTGCAGATCATGCGACTGTTGGACCACCCGAATATTGTAGCTTTGAAGCATTGCTTCTTCTCGACGACGGATAAAGACGAATTGTACTTAAACCTGGTGCTGGAGTATGTACCCGAGACGGTGTATCGTATTGCAAAGCACTACAATCGCATGAATCAGCGAATGCCCCTTGTTTACGTGAAACTGTACACGTATCAGATATGCCGATCACTGGCATATATCCACAATGGCATCGGTGTCTGCCACCGCGACATCAAGCCCCAGAACCTGCTGGTGAATCCTCATACGCACCAGCTGAAACTGTGTGATTTTGGAAGTGCGAAAGTGCTGGTGAAAGGGGAGCCCAATATCTCGTACATTTGTTCGCGGTACTACCGTGCTCCGGAGCTTATTTTTGGAGCGACGGAGTACACGACTGCCATAGATATATGGTCGATGGGTTGCGTGATGGCAGAGCTTCTACTAGGACAGCCTTTGTTTCCTGGAGAGAGTGGAGTGGATCAATTGGTGGAAATCATCAAGGTTTTGGGGACACCGACTCGTGAGGAGATCAAGTGCATGAATCCGAACTACACAGAGTTCAAGTTTCCACAAATCAAGGCGCACCCGTGGCACAAAGTTTTCCACAAACGCATGCCACCTGAAGCAGTTGACTTGGTGTCAAGGCTCCTTCAGTACTCTCCAAATCTGCGGTGCAACGCTCTGGAAGCGTGTGTGCACCCGTTCTTTGATGAGCTAAGGGATCCTAACTGCCGGCTTCCGAATGGGCGGCCACTGCCCTCTCTGTTCAACTTCAAAACCCAAGAGTTGAAGGGTGCAACTCCTGATATTCTGCAGCGTTTGATACCCGAGCACGCGAGGAAGCAGAATCCGATGCTGGCGCTGTGAGGGGTGCCTGGAAAGAGATCGGAAGAGTCTACTGCGTGAAAGGTTTTCCTCTGTTTGGAGGAGTGGTCCGCTTTGTGGAGGGCTTCATAGGCACTCTGTATCATTGCTTAAACACGTAAAGTCAACCAATTTGCTATGGATCCCTGCTTTCGCTGTGATTGGAGGAAGACTTAGTAGACGATTAGCATGCCACTTTTAGGAACGGCAATTCTCCTGTAGTGAAGGTTACGATTCTATTGTACTTCAGAACGGTAAAGGTATTTAGGGGTTCTCAGTGCTTCCTGATTTGGGTACGTGATGTACCATTGGAAAGGCTTCAAACGCATGTATATCTATGAGACTTTGACGTTACTTTTTATCGTCAGTACTCAGGAAGCTCCTCTCTG


Protein sequences

Name Description Sequence
Ppa.130 translated coding region predicted by ESTScan from UniGene Ppa.130

MASATAGIINSTNMIGGGIAPTKAGSSGVELLPKEMHDMKLRDDKVDHSDDKEIEASIVDGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFFDELRDPNCRLPNGRPLPSLFNFKTQELKGATPDILQRLIPEHARKQNPMLALXGVPGKRSEESTA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24057
7-418 FAMILY NOT NAMED,GLYCOGEN SYNTHASE KINASE-3 ALPHA

GIINSTNMIGGGIAPTKAGSSGVELLPKEMHDMKLRDDKVDHSDDKEIEASIVDGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFFDELRDPNCRLPNGRPLPSLFNFKTQELKGATPDILQRLIPEHARKQN

Gene3D: G3DSA:3.30.200.20
81-162 no description

PKQTISYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVL

superfamily: SSF56112
IPR011009
86-402 Protein kinase-like (PK-like)
Protein kinase-like domain

SYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFFDELRDPNCRLPNGRPLPSLFNFKTQELKGAT

ProfileScan: PS50011
IPR000719
87-371 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFF

HMMSmart: SM00220
IPR002290
87-371 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFF

HMMSmart: SM00219
IPR020635
87-371 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFF

HMMPfam: PF00069
IPR017442
88-371 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFF

PatternScan: PS00107
IPR017441
93-117 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGTGSFGIVFQAKCIETGETVAIKK

Gene3D: G3DSA:1.10.510.10
163-377 no description

EYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFFDELRDP

PatternScan: PS00108
IPR008271
208-220 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VCHRDIKPQNLLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox