PRGDB00073977 (Ppa.441)

From PRG Wiki
Jump to: navigation, search
Ppa.441
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 28172865 (AJ515321)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Physcomitrella patens

Comment?

Physcomitrella patens mRNA for putative cyclin dependent kinase A (cdk-A gene)

DNA Sequence

GAATTCGGCACGAGCGCCAGCCAGCCTCGTATCTGACTGCCTTGTCGCGCGTGCCCCCTTGTGACGCATCTTCGTGCCTCACTAAGAAGCCCTCCCGGATTGTCCTGTCTTCATTCGTGCCTACAAATTGGCCGCATTTCGCTCCCGCATTCTGCGATGAATAAGGCTGCATCAGCTTTGCCGTCCATCGTGTTTTGTTTCGTCTTCACTTCTCGTTTTGTGCGGAGCTGGTACTCCATCAGGCGATTTGGTCTGATCTCGTTACCTCAAGTTTCAAATGGATCAGTATGAGAAAGTGGAGAAGATTGGAGAGGGCACATACGGTGTCGTATACAAGGCCCGGGATCGCCTCACTAATGAAACTATTGCTCTGAAAAAAATACGGCTGGAGCAAGAAGATGAAGGTGTTCCAAGCACCGCCATTCGAGAAATTTCACTCCTGAAAGAAATGCACCATGGCAACATCGTTCGGCTACAAGATGTGGTGCATAGTGAGAAACGATTGTACTTGGTTTTTGAATACCTGGACCTCGACCTAAAGAAGCATATGGACACCTGCCCGGACCTTGCCAAAGACCCACGCTTGATCAAGACCTTTCTATACCAGATCTTGCGGGGCATTGCTTATTGCCATGCCCACAGGGTCCTTCACAGAGACTTGAAACCTCAGAATCTTTTGATTGATCGACGTACCAATGCTTTGAAGCTAGCTGACTTTGGCCTTGCACGAGCTTTTGGTATTCCTGTCAGGACATTCACTCATGAGGTGGTAACATTGTGGTACAGAGCACCAGAAATTCTCTTAGGTTCTCGCCACTACTCTACACCTGTAGATGTGTGGTCTGTAGGATGCATTTTCGCTGAGATGGTCAATCAACGGCCCTTGTTTCCAGGAGATTCTGAGATAGATGAGCTGTTCAAAATCTTCAGGACACTTGGCACTCCAAATGAAGAAGTTTGGCCAGGTGTAACTTCATTGCCAGATTTCAAGACTGCTTTTCCAAAGTGGCCTCCGAAGCCTTTGTCATCAGTCGTACCTAGCCTTGAGCCAGCAGGCATCGACTTGCTAGAGGTATGTGATCTTTCAACTCCGGCATCTGAATTCTGTGTGGttttgtttttttttATTATTTCTACTTTTAGTCTAATTGTTCGCCTTAAGCAATGCATGCAGTCATATGCCTCTTGAAACCAGAATGATGGGAGCAGCGTATTCGGATATTGCAATTTGTTCCAATATCGGTTTCCAAGTCTTACGTTATTAGGACACCTGAAACAGAAAATGCTGACACTTGAGCCAAGTCGACGGGTAACAGCACGAAATGCATTGGAACACGAGTATTTCAAGGATATCGGTCTTGTACCCTGATTCTTGTATGCAACTTGTATGATACTGTCTAGGGTATCCCTGCAAGGCAGCTACTTTAGATTCTGAAGATCGGATTGCCTCCGTCGCCTTTCCTACTATgcaaaaaaaatgccattttttttcccaacaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ppa.441 translated coding region predicted by ESTScan from UniGene Ppa.441

XIRHERQPASYLTALSRVPPCDASSCLTKKPSRIVLSSFVPTNWPHFAPAFCDXIRLHQLCRPSCFVSSSLLVLCGAGTPSGDLVXSRYLKFQMDQYEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDTCPDLAKDPRLIKTFLYQILRGIAYCHAHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRTLGTPNEEVWPGVTSLPDFKTAFPKWPPKPLSSVVPSLEPAGIDLLEVCDLSTPASEFCVVLFFFIISTFSLIVRLKQCMQSYASXNQNDGSSVFGYCNLFQYRFPSLTLLGHLKQKMLTLEPSRRVTARNALEHEYFKDIGLVP

Domains

Domain Start-End Description Sequence

Seg: seg
67-74 seg

VSSSLLVL

superfamily: SSF56112
IPR011009
83-452 Protein kinase-like (PK-like)
Protein kinase-like domain

DLVXSRYLKFQMDQYEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDTCPDLAKDPRLIKTFLYQILRGIAYCHAHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRTLGTPNEEVWPGVTSLPDFKTAFPKWPPKPLSSVVPSLEPAGIDLLEVCDLSTPASEFCVVLFFFIISTFSLIVRLKQCMQSYASXNQNDGSSVFGYCNLFQYRFPSLTLLGHLKQKMLTLEPSRRVTARNALEHEYFKDI

Gene3D: G3DSA:3.30.200.20
93-171 no description

QMDQYEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHGNIVRLQDVVHSEKRLYL

HMMPanther: PTHR24056:SF109
94-452 SUBFAMILY NOT NAMED,SHAGGY-RELATED PROTEIN KINASE

MDQYEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDTCPDLAKDPRLIKTFLYQILRGIAYCHAHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRTLGTPNEEVWPGVTSLPDFKTAFPKWPPKPLSSVVPSLEPAGIDLLEVCDLSTPASEFCVVLFFFIISTFSLIVRLKQCMQSYASXNQNDGSSVFGYCNLFQYRFPSLTLLGHLKQKMLTLEPSRRVTARNALEHEYFKDI

HMMPanther: PTHR24056
94-452 FAMILY NOT NAMED,CELL DIVISION PROTEIN KINASE

MDQYEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDTCPDLAKDPRLIKTFLYQILRGIAYCHAHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRTLGTPNEEVWPGVTSLPDFKTAFPKWPPKPLSSVVPSLEPAGIDLLEVCDLSTPASEFCVVLFFFIISTFSLIVRLKQCMQSYASXNQNDGSSVFGYCNLFQYRFPSLTLLGHLKQKMLTLEPSRRVTARNALEHEYFKDI

ProfileScan: PS50011
IPR000719
97-449 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDTCPDLAKDPRLIKTFLYQILRGIAYCHAHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRTLGTPNEEVWPGVTSLPDFKTAFPKWPPKPLSSVVPSLEPAGIDLLEVCDLSTPASEFCVVLFFFIISTFSLIVRLKQCMQSYASXNQNDGSSVFGYCNLFQYRFPSLTLLGHLKQKMLTLEPSRRVTARNALEHEYF

HMMPfam: PF00069
IPR017442
97-449 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDTCPDLAKDPRLIKTFLYQILRGIAYCHAHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRTLGTPNEEVWPGVTSLPDFKTAFPKWPPKPLSSVVPSLEPAGIDLLEVCDLSTPASEFCVVLFFFIISTFSLIVRLKQCMQSYASXNQNDGSSVFGYCNLFQYRFPSLTLLGHLKQKMLTLEPSRRVTARNALEHEYF

HMMSmart: SM00219
IPR020635
97-349 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDTCPDLAKDPRLIKTFLYQILRGIAYCHAHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRTLGTPNEEVWPGVTSLPDFKTAFPKWPPKPLSSVVPSL

HMMSmart: SM00220
IPR002290
97-449 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDTCPDLAKDPRLIKTFLYQILRGIAYCHAHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRTLGTPNEEVWPGVTSLPDFKTAFPKWPPKPLSSVVPSLEPAGIDLLEVCDLSTPASEFCVVLFFFIISTFSLIVRLKQCMQSYASXNQNDGSSVFGYCNLFQYRFPSLTLLGHLKQKMLTLEPSRRVTARNALEHEYF

PatternScan: PS00107
IPR017441
103-126 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGTYGVVYKARDRLTNETIALK

PatternScan: PS00108
IPR008271
216-228 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDLKPQNLLI

Seg: seg
335-351 seg

PKWPPKPLSSVVPSLEP

Seg: seg
371-385 seg

VVLFFFIISTFSLIV

Gene3D: G3DSA:1.10.510.10
420-450 no description

TLLGHLKQKMLTLEPSRRVTARNALEHEYFK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox