PRGDB00074006 (Ppa.2073)

From PRG Wiki
Jump to: navigation, search
Ppa.2073
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 168021130 (XM_001763043)
Gene Class Unknown
Domain Type
Gene Species Physcomitrella patens

Comment?

Physcomitrella patens subsp. patens predicted protein (PHYPADRAFT_210069) mRNA, complete cds

DNA Sequence

AGTTCCTGTACGGCGAATTTCACCCCTGCATTGGAATCGAAGGTGATGGTTGGAGGAGTTGTGTATCATCAGCCACCCCGTCACTGCGGATCCCGCATCGTCGTTCTCATTCGCCTGATTGTCTGGCAATCACGCTGATGTTCAGGTAGCTGGTTGCTGATTAGACGTCAAAGACGATCTAGTATAGGGCTGACGGAGTCAAGGTCTTGTGTGTCTCAAAAGCTGAATCGGGCTCTCAGCGTGAAGGTGTGGGAAGGTATTAAGCTGTCAAGAACTTTGTTTACAGTGATTCAACGCAGTTGGAGAATTTCATAACAGATGAGCGGTTGCTGCTTGATTCGAAGGAGCTGGAGGAAGTTTTCTCGTGAGATTTGCTGAAACTCGGTTTGGTTGACTGGAGAGTAGTGGTGGTTGTGAGAACGAGTTCAAGCCAGCAGGTGAGATGGAGTTGTTTCCAGCGCCAGGGAGAAACCACTTGTTTGTGCCGGGGCCTACCAACATTCCAGACAGAGTGCTGCAGGCCATGAACCGCAACAATGAGGATCACCGATCGCCGACTTTTCCCGCACTGGCTAAGTCCGTTCTTGAGGACGTCAAGCTGCTGTTCCGCACACAGACTGGCACCCCCTTCATCTTCCCTTCCTCAGGTACAGGAGCATGGGAGAGTGCGCTAACCAACACGATGTCACCAGGTGACAGGATCATCGTCCCGAGGATGGGCCAATTCTGTGTCCTCTGGATCAACCTCATGACCCGTCTCCACTTCAACGTGGATGTGATCGAGTGCGAGTGGGGCGAGGGCATCGATCTGGAGATCCTCAAGCAGAAGCTGCAGTCAGATCATACTCATGCTGTGAAGGCAGTCTGCGTGGTGCACAACGAAACCTCCACGGGCGTGACTAACGACTTAAGTGCCGTTCGCAAAGCCCTTGACGAGGCAAGACATCCTGCATTGCTACTCGTGGATGGAGTCTCGTCGGTTGGCGCCATGGATTTTCGAATGGACGACTGGGGAGTGGACGTGGCCCTCACCGGATCCCAGAAAGCCCTATCTCTTCCAACCGGTCTAGGTATCCTTTGCGCCAGCCTCAAAGCTATTGAAACTTCCAAGCAAGCAAAATACCCACGGGGCTACTTCGACTGGGCAGAATATCTAAAAAGCTACAAGGCAGGGACGTATTCCCCCTACACTCCGTCCGTCCAACTGCTCTACGGGCTGCGTGCCTCCCTTGACATTATCCTCAAACAAGAGGGACTGGAAAATGTCATAGCCCGGCATCTGCGTCTTGCTGAAGCAACCAGGAGAGCTGTGAGAGCTTGGGGACTTACCGTCTGCGCAAGGAAGCCCCAGTGGGACAGCGCGGTCGTGACAGGAGTGGTGGTGCCGTCTTCATTAGACAGCAACGACGTGATCAAGATTGCATGGAAGAAGTACAATCTCAGCCTTGGTCTCGGTCTCGGCGAAGTGAACGGAAAGGTGTTTCGCATTGGACATCTAGGCTATGTGAATGAGCTACAATTACTAGGAGCTTTGGCGGGAGTGGAGCTCGTGCTCCTCGAGGTTGGATATCCCGTAATCTTTGGCAGTGGTGTTGCCGCAGCCCAGGCATTTCTATCCAAGCAAACCCCTATAATTGCCTCCCGCCTGTGATAACCGCGACCCACGAACGCCCCAACCACCAACATCCTTGCAAGTAAAGGGAGCAGAGTCGCATCATTCAGCCCTCGGAGAAGCTCCATCACTTGAACGTGCTCTCTCAGTATCCCGAAGTTTTGTCCTTGACGACTTTACTTCCACTTCTATACAAAGCAAAGCATACACTCGGATTGCAAGACTATACACCATCGGGTGGACTACTATAACAATTATGTACAGACGTTGATTTAGTACTCTCCGAACATTCAATCAATGATGGTCAACAATTGCAAATTACCTTGGATTGAAAATAAAGGCTTCGTGTTCCAGCGGAACGCGGAGGAACTGTAGGCTACCCGTGCATGACAAATTTTGAGAATGTTGAAGAAAAATGACGGCATCTGCAGAGCCTCTGAATACGATTGTTTGGAACATTGTAATGAGCCAGGCAAGTACAGATGGTAATATCATGGTAATATCATCTGTACAAGATGTGGAAGCAATGAAAGTACCGTAATGTCACAAAT


Protein sequences

Name Description Sequence
Ppa.2073 translated coding region predicted by ESTScan from UniGene Ppa.2073

SSCTANFTPALESKVMVGGVVYHQPPRHCGSRIVVLIRLIVWQSRXCSGSWLLIRRQRRSSIGLTESRSCVSQKLNRALSVKVWEGIKXVKNFVYSDSTQLENFITDERLLLDSKELEEVFSXDLLKLGLVXLESSGGCENEFKPAGEMELFPAPGRNHLFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTGTPFIFPSSGTGAWESALTNTMSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEGIDLEILKQKLQSDHTHAVKAVCVVHNETSTGVTNDLSAVRKALDEARHPALLLVDGVSSVGAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEYLKSYKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTVCARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNELQLLGALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPKLPPACDNRDPRTPQPPTSLQVKGAESHHSALGEAPSLERALSVSRSFVLDDFTSTSIQSKAYTRIARLYTIGWTTITIMYRR

Domains

Domain Start-End Description Sequence

Seg: seg
122-138 seg

SXDLLKLGLVXLESSGG

HMMPanther: PTHR21152:SF7
148-553 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EMELFPAPGRNHLFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTGTPFIFPSSGTGAWESALTNTMSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEGIDLEILKQKLQSDHTHAVKAVCVVHNETSTGVTNDLSAVRKALDEARHPALLLVDGVSSVGAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEYLKSYKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTVCARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNELQLLGALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPKLPPACDNR

HMMPanther: PTHR21152
148-553 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

EMELFPAPGRNHLFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTGTPFIFPSSGTGAWESALTNTMSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEGIDLEILKQKLQSDHTHAVKAVCVVHNETSTGVTNDLSAVRKALDEARHPALLLVDGVSSVGAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEYLKSYKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTVCARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNELQLLGALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPKLPPACDNR

superfamily: SSF53383
IPR015424
155-526 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNHLFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTGTPFIFPSSGTGAWESALTNTMSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEGIDLEILKQKLQSDHTHAVKAVCVVHNETSTGVTNDLSAVRKALDEARHPALLLVDGVSSVGAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEYLKSYKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTVCARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNELQLLGALAGVELVLLEVGYPV

HMMPfam: PF00266
IPR000192
160-477 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTGTPFIFPSSGTGAWESALTNTMSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEGIDLEILKQKLQSDHTHAVKAVCVVHNETSTGVTNDLSAVRKALDEARHPALLLVDGVSSVGAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEYLKSYKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTVCARKPQWDSAVVTGVVVPSSLDSNDVIKIAWK

Gene3D: G3DSA:3.40.640.10
IPR015421
169-405 no description
Pyridoxal phosphate-dependent transferase, major r

PDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTGTPFIFPSSGTGAWESALTNTMSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEGIDLEILKQKLQSDHTHAVKAVCVVHNETSTGVTNDLSAVRKALDEARHPALLLVDGVSSVGAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEYLKSYKAGTYSPYTPSVQLLY

PatternScan: PS00595
IPR020578
340-360 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGLGIL

Gene3D: G3DSA:3.90.1150.10
IPR015422
406-532 no description
Pyridoxal phosphate-dependent transferase, major r

GLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTVCARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNELQLLGALAGVELVLLEVGYPVIFGSGV

Seg: seg
505-523 seg

ELQLLGALAGVELVLLEVG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox