PRGDB00074114 (Ppa.10277)

From PRG Wiki
Jump to: navigation, search
Ppa.10277
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 208389134 (DC945710)
Gene Class Unknown
Domain Type LRR
Gene Species Physcomitrella patens

Comment?

DC945710 ppgs full-length cDNA library; green sporophytes Physcomitrella patens subsp. patens cDNA clone ppgs8p08 3', mRNA sequence

DNA Sequence

CTTCAACATGCACTTTCATGCAAACTTCCCGATGAGTCTCAAAAGTTTCAATCTTCCAACAATTGATTGGACTTATGAGATTGTTAGCAGGGGTTGGAAAGTGGAGGACCGCATAGACCAGGATTGCCTGGGCGGAAAGCGTTCGCACTGAGGCTCTGCATAGCCTTTGGAATCGGACCTTTAAGCATGTTGTTGGTAAGATCGATGGGATCGGATACAAGAGGATCAAATGGGCCATAATTTGATGGGATGCCTCCTGTAATCTTATTGTTCTGCAATTTGACGAAAGTGAGTTCCGGAAGGTCACCAAGTTCGCGAGGAAGGGGGCCAGAAAGCTTGTTTTTGTCAGCAGTCAACTCTACCAAGTTCTTCAGCTTGCCTAACTCACGTGGTAGTGGACCAGACAGCGAGTTCTGGCCCAGAATTAGATACATGAGCGATGTGCACTTGCCAATGCCCGCAGGAATTCGCCCGCTGAGCTTATTGCCTCGGAGTGCGAGGTACCGCATTCCTCTTATGTTGCATAGCTCGGCAGGAATGGTGCCAGAAAATTGGTTGAAGCTGAGAAGAAGCTCGTTGAAGAAAGGGCCTGCTAGGGTTAGGCCTCCCAGCCACTTGGGTATGGAACCGGTAATCTTGTTACGGGAGAAATCTACTCGGTCAAGTTTCTGCANCAAGGTAAGTTTCCAGGACCCGAGCGTTGTGAGCTGGTTGCTCCAAGTTGCAAAATCCGTAATCCTTA


Protein sequences

Name Description Sequence
Ppa.10277 translated coding region predicted by ESTScan from UniGene Ppa.10277

XRITDFATWSNQLTTLGSWKLTLXQKLDRVDFSRNKITGSIPKWLGGLTLAGPFFNELLLSFNQFSGTIPAELCNIRGMRYLALRGNKLSGRIPAGIGKCTSLMYLILGQNSLSGPLPRELGKLKNLVELTADKNKLSGPLPRELGDLPELTFVKLQNNKITGGIPSNYGPFDPLVSDPIDLTNNMLKGPIPKAMQSLSANAFRPGNPGLCGPPLPTPANNLISPINCWKIETFETHREVCMKVHVEX


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
11-199 no description

NQLTTLGSWKLTLXQKLDRVDFSRNKITGSIPKWLGGLTLAGPFFNELLLSFNQFSGTIPAELCNIRGMRYLALRGNKLSGRIPAGIGKCTSLMYLILGQNSLSGPLPRELGKLKNLVELTADKNKLSGPLPRELGDLPELTFVKLQNNKITGGIPSNYGPFDPLVSDPIDLTNNMLKGPIPKAMQSLS

superfamily: SSF52058
11-219 L domain-like,LRR

NQLTTLGSWKLTLXQKLDRVDFSRNKITGSIPKWLGGLTLAGPFFNELLLSFNQFSGTIPAELCNIRGMRYLALRGNKLSGRIPAGIGKCTSLMYLILGQNSLSGPLPRELGKLKNLVELTADKNKLSGPLPRELGDLPELTFVKLQNNKITGGIPSNYGPFDPLVSDPIDLTNNMLKGPIPKAMQSLSANAFRPGNPGLCGPPLPTPA

HMMPfam: PF00560
IPR001611
27-48 LRR_1
Leucine-rich repeat

LDRVDFSRNKITGSIPKWLGGL

HMMPanther: PTHR24420
31-220 FAMILY NOT NAMED,FAMILY NOT NAMED

DFSRNKITGSIPKWLGGLTLAGPFFNELLLSFNQFSGTIPAELCNIRGMRYLALRGNKLSGRIPAGIGKCTSLMYLILGQNSLSGPLPRELGKLKNLVELTADKNKLSGPLPRELGDLPELTFVKLQNNKITGGIPSNYGPFDPLVSDPIDLTNNMLKGPIPKAMQSLSANAFRPGNPGLCGPPLPTPAN

Seg: seg
205-218 seg

PGNPGLCGPPLPTP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox