PRGDB00074132 (Ppa.11586)

From PRG Wiki
Jump to: navigation, search
Ppa.11586
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 208392135 (DC957242)
Gene Class Unknown
Domain Type LRR
Gene Species Physcomitrella patens

Comment?

DC957242 ppgs full-length cDNA library; green sporophytes Physcomitrella patens subsp. patens cDNA clone ppgs23n08 3', mRNA sequence

DNA Sequence

CATTTTCCCGGTCTTCATTTCTTCTCTAAGCTTGTCCACTGGAAGTCTAACCTTTCCTTGATTCCTTCAAATATTCCTGCTCAGGATATTGGGACAGCTCAAGGTAAGCTCCCATGGTCCTTGTCAAGCTAACAAGAGTCGGCATCTTTCCCCGCTAATCAAAGGTACTCTTGGAGAAAAGCAAGCCACGAAAGGAAACCAAAAAAATTCGTCACTAGTAGCCAGGCAATCTGAGTTCTTTAGTGGCAAGACATCTCGTAAGGAACGAAGCCCTCAAGCTCAGGTCCATTCAGACGAGGGTTGTTATCAAAGCTCTTGGCTTGAAGATGACTGAAAGAGCCCGTGACCGGAATTGTGCCGCACAAGTCATTGTTTGAAAAATCGACAGCTTTGAGGGTGGTGATTGACGTCAATTCACGTGGAATACGACCAGTCAGCTTGTTATTGTTCAGACGTAGAAATGCCAGATTGGATAGCTTTCCAAGAGAGCGAGGAATGGAGCCTGTAAAATTGTTGTGGTACAAGTCCAAACTCACGAGAGACTTCAACTTGCCAAGTTCCGAGGGAATGTGACCAGTGAGGCTGTTCTTGTACAACTCCAGGTACTGCAGGTTCTGAAGTGCTCCAAGTTCAGAGACCAAAGAGCCGGACAGGCGAGCATTCCCAAGATCCACTCGGATGACTCGATTTTGGCCGTCACACGTCACATGGAACCAGGTGCAAGGATTGACCAAGGTAGGATCCCAGCTTTGCAACACATTCGATGGATCAGTCAAACTCCGGCGGAGAGCATACAGCGCATCTCCTTCAGAGTTAGCAAGTGCGGCAGGTAGAAGAGCGCCAACCAACAATGCATACAAAACCAATCTTCCACCTGAGTTCTCCATTTTCAGCAAagcacagctgcagcangcatgcaagcaagcaagcgagcaagcaagcgagcaagcaNCCCC


Protein sequences

Name Description Sequence
Ppa.11586 translated coding region predicted by ESTScan from UniGene Ppa.11586

GXACSLACSLACLHACCSCALLKMENSGGRLVLYALLVGALLPAALANSEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCDGQNRVIRVDLGNARLSGSLVSELGALQNLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFTGSIPRSLGKLSNLAFLRLNNNKLTGRIPRELTSITTLKAVDFSNNDLCGTIPVTGSFSHLQAKSFDNNPRLNGPELEGFVPYEMSCH

Domains

Domain Start-End Description Sequence

Seg: seg
3-22 seg

ACSLACSLACLHACCSCALL

HMMPanther: PTHR24420:SF836
13-228 SUBFAMILY NOT NAMED

LHACCSCALLKMENSGGRLVLYALLVGALLPAALANSEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCDGQNRVIRVDLGNARLSGSLVSELGALQNLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFTGSIPRSLGKLSNLAFLRLNNNKLTGRIPRELTSITTLKAVDFSNNDLCGTIPVTGSFSHLQAKSFDNNPRLNGPELE

HMMPanther: PTHR24420
13-228 FAMILY NOT NAMED,FAMILY NOT NAMED

LHACCSCALLKMENSGGRLVLYALLVGALLPAALANSEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCDGQNRVIRVDLGNARLSGSLVSELGALQNLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFTGSIPRSLGKLSNLAFLRLNNNKLTGRIPRELTSITTLKAVDFSNNDLCGTIPVTGSFSHLQAKSFDNNPRLNGPELE

Seg: seg
31-47 seg

LVLYALLVGALLPAALA

superfamily: SSF52058
44-231 L domain-like,LRR

AALANSEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCDGQNRVIRVDLGNARLSGSLVSELGALQNLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFTGSIPRSLGKLSNLAFLRLNNNKLTGRIPRELTSITTLKAVDFSNNDLCGTIPVTGSFSHLQAKSFDNNPRLNGPELEGFV

HMMPfam: PF08263
IPR013210
47-87 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ANSEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCD

Gene3D: G3DSA:3.80.10.10
49-220 no description

SEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCDGQNRVIRVDLGNARLSGSLVSELGALQNLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFTGSIPRSLGKLSNLAFLRLNNNKLTGRIPRELTSITTLKAVDFSNNDLCGTIPVTGSFSHLQAKSFDNNP

HMMPfam: PF12799
115-151 LRR_4,Leucine Rich repeats (2 copies)

NLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFT

HMMPfam: PF13504
162-176 LRR_7,Leucine rich repeat

SNLAFLRLNNNKLTG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox