PRGDB00074210 (Ppa.15301)

From PRG Wiki
Jump to: navigation, search
Ppa.15301
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 208367400 (DC951304)
Gene Class Unknown
Domain Type LRR
Gene Species Physcomitrella patens

Comment?

DC951304 ppgs full-length cDNA library; green sporophytes Physcomitrella patens subsp. patens cDNA clone ppgs27f22 3', mRNA sequence

DNA Sequence

CTCCCATATACTTGAGAATTTCTACAAGATTAGGATCCTACTAAAATACACGCCAATCTCTATAAGAGAGTGTGGAATCACTTATTAGCTTAAATCCTGAGTACAACGTATTACGAGGAGAGAGCGAGGGAGGCTGAATCAAAATTCTATTCCGGGCTCAGTTCGCGTCGGTGGACATGCTCCCACGATTGCATCCTGATTTTCAAGGCAAATCGATATAATGCAAAATCGAGTGCTGTTTACAAGAACAATAGGGCAGTGGAGAGAGCTCCGAATGAAACGACAATGGAAAAGGTGATGGTAAGGGCAGAGGCAACAGCAGGCTGGCCGGGGCTGGTGCTCTGGCCCTGGTTGCTGTAGGAAACCATGACGGAATCCTGAGCCTGTAAGCAAGTCGGGACGAGGATGTAGTTCATGTCGTTGTAAGAGACGTCAATGTGTTTGATGTTCTTGTGGTTGCAGAAGGAGGAGGGGATGGAGCCCGTGAGGTGGTTGGACTTGAGGTCCAGCTTCTCCAGGCTTTGGATGCCGGCTAAGTTGGAGGGGATGTCATCTCGGAGATTGGCGTTGTTGATAGTGATGGACACGAGGTTGTTGGAGAATTCGCCCCACTGCAAGGGAATGGGGCCATTCAAGAGAACCCACTGGATCTTGAGCTTTCGCAGATAAGTGAGGTTCACCAGCCCTGCGCCTACGGTTCCCCCTTGGTAACTTGTGTCGCGGTAGGTCTGCTGATTATACGCTGACGTTCCCTTGATCTCAAGCTCCAGGATGGCGCCATCTCCCTCTCGACACTTGACGCCGCTCCATGTGCAGCAATTAGTGCTTGCATCCCAGGTTGAAAACACCATGTTCCTGTCAATAAACCCCGACTTGAAATCTATCAATATCTGCGTATCCGTGGGCGAGCAGTTCCACGCTCTGCATCCTGANATGGCCAACAAGAGCCCTACCGCAATTTGANCGAGCANATCAACCTTTCCTTG


Protein sequences

Name Description Sequence
Ppa.15301 translated coding region predicted by ESTScan from UniGene Ppa.15301

QGKVDXLXQIAVGLLLAXSGCRAWNCSPTDTQILIDFKSGFIDRNMVFSTWDASTNCCTWSGVKCREGDGAILELEIKGTSAYNQQTYRDTSYQGGTVGAGLVNLTYLRKLKIQWVLLNGPIPLQWGEFSNNLVSITINNANLRDDIPSNLAGIQSLEKLDLKSNHLTGSIPSSFCNHKNIKHIDVSYNDMNYILVPTCLQAQDSVMVSYSNQGQSTSPGQPAVASALTITFSIVVSFGALSTALLFL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
14-192 FAMILY NOT NAMED,FAMILY NOT NAMED

LLLAXSGCRAWNCSPTDTQILIDFKSGFIDRNMVFSTWDASTNCCTWSGVKCREGDGAILELEIKGTSAYNQQTYRDTSYQGGTVGAGLVNLTYLRKLKIQWVLLNGPIPLQWGEFSNNLVSITINNANLRDDIPSNLAGIQSLEKLDLKSNHLTGSIPSSFCNHKNIKHIDVSYNDMN

superfamily: SSF52058
24-194 L domain-like,LRR

WNCSPTDTQILIDFKSGFIDRNMVFSTWDASTNCCTWSGVKCREGDGAILELEIKGTSAYNQQTYRDTSYQGGTVGAGLVNLTYLRKLKIQWVLLNGPIPLQWGEFSNNLVSITINNANLRDDIPSNLAGIQSLEKLDLKSNHLTGSIPSSFCNHKNIKHIDVSYNDMNYI

Gene3D: G3DSA:3.80.10.10
26-194 no description

CSPTDTQILIDFKSGFIDRNMVFSTWDASTNCCTWSGVKCREGDGAILELEIKGTSAYNQQTYRDTSYQGGTVGAGLVNLTYLRKLKIQWVLLNGPIPLQWGEFSNNLVSITINNANLRDDIPSNLAGIQSLEKLDLKSNHLTGSIPSSFCNHKNIKHIDVSYNDMNYI

HMMPfam: PF08263
IPR013210
28-65 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PTDTQILIDFKSGFIDRNMVFSTWDASTNCCTWSGVKC

HMMPfam: PF00560
IPR001611
156-177 LRR_1
Leucine-rich repeat

SLEKLDLKSNHLTGSIPSSFCN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox