PRGDB00074225 (Ppa.16405)

From PRG Wiki
Jump to: navigation, search
Ppa.16405
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 208386194 (DC949105)
Gene Class Unknown
Domain Type
Gene Species Physcomitrella patens

Comment?

DC949105 ppgs full-length cDNA library; green sporophytes Physcomitrella patens subsp. patens cDNA clone ppgs19f11 3', mRNA sequence

DNA Sequence

TGGACTCAACATTGCTTGAGCTCGCACAGTGACCAATCATATCATACTGAGTCATTAGACCTTACAGCAGTGACGATATGCCACCACACAACTCAAACCTACAAGTGGATTGCACCCTAAGTTGATAACCATACAAGTCTGATGAAACACCACAAAATGCTGAACCGCATATCGTGTTTACCAAACAATCTACTGTAAGTGAAGAAATCATATGCTTTTGCAAGATATGTTGTGCTATGTCATCTATTGGCTCAGGAACATTCCAAAAACCTCCACAGCAAGTGCTCCTACCCATCTTCAGAGTCTGAGCGAACGTCCTCTCCAACTTTTCCGGAATTTCGTAATTGCTGGTGCTCCAGATAATCCAGAAAGGAAAGTAGATCAGCCGCAAAAGCACCCACGATAGTACAAATAGGCCAAAGGAGACGCTGGCCCCCACCTCGCTACCACTGTATTTGCAGAGCTTCGCAGCTTCCATGAAAACATCACTTACATCATGAAGGGCAAGCACAATGGAACCTGCACGAAAGGACCCGGTGATATAAGAATAAGCGATGAGTCCAATTGTCACAATATGATGAGTCATCATAACATCAAAATCCTTCCTTCGAGTTTCCCAGAATAACAATGCCGCCACACTATATATGTAGAAGCCACATTGAAAGGTGTAGAACAACGTCAGCTGAAACTTCACAGTTTGATACGGCCATCCGTGCCAAAACGCANAGGTGTTGCCGAACCATGCCTCTTTGTAGGTATGAAGATANCAACACTTCCGTAG


Protein sequences

Name Description Sequence
Ppa.16405 translated coding region predicted by ESTScan from UniGene Ppa.16405

LRKCXYLHTYKEAWFGNTXAFWHGWPYQTVKFQLTLFYTFQCGFYIYSVAALLFWETRRKDFDVMMTHHIVTIGLIAYSYITGSFRAGSIVLALHDVSDVFMEAAKLCKYSGSEVGASVSFGLFVLSWVLLRLIYFPFWIIWSTSNYEIPEKLERTFAQTLKMGRSTCCGGFWNVPEPIDDIAQHILQKHMISSLTVDCLVNTICGSAFCGVSSDLYGYQLRVQSTCRFELCGGISSLLXGLMTQYDMIGHCASSSNVESX


Domains

Domain Start-End Description Sequence

ProfileScan: PS50922
IPR006634
1-169 TLC
TRAM/LAG1/CLN8 homology domain

LRKCXYLHTYKEAWFGNTXAFWHGWPYQTVKFQLTLFYTFQCGFYIYSVAALLFWETRRKDFDVMMTHHIVTIGLIAYSYITGSFRAGSIVLALHDVSDVFMEAAKLCKYSGSEVGASVSFGLFVLSWVLLRLIYFPFWIIWSTSNYEIPEKLERTFAQTLKMGRSTCC

HMMSmart: SM00724
IPR006634
1-177 TRAM, LAG1 and CLN8 homology domains.
TRAM/LAG1/CLN8 homology domain

LRKCXYLHTYKEAWFGNTXAFWHGWPYQTVKFQLTLFYTFQCGFYIYSVAALLFWETRRKDFDVMMTHHIVTIGLIAYSYITGSFRAGSIVLALHDVSDVFMEAAKLCKYSGSEVGASVSFGLFVLSWVLLRLIYFPFWIIWSTSNYEIPEKLERTFAQTLKMGRSTCCGGFWNVPE

HMMPanther: PTHR12560
9-154 FAMILY NOT NAMED,LONGEVITY ASSURANCE FACTOR 1 (LAG1)

TYKEAWFGNTXAFWHGWPYQTVKFQLTLFYTFQCGFYIYSVAALLFWETRRKDFDVMMTHHIVTIGLIAYSYITGSFRAGSIVLALHDVSDVFMEAAKLCKYSGSEVGASVSFGLFVLSWVLLRLIYFPFWIIWSTSNYEIPEKLE

HMMPfam: PF03798
IPR006634
20-148 TRAM_LAG1_CLN8
TRAM/LAG1/CLN8 homology domain

AFWHGWPYQTVKFQLTLFYTFQCGFYIYSVAALLFWETRRKDFDVMMTHHIVTIGLIAYSYITGSFRAGSIVLALHDVSDVFMEAAKLCKYSGSEVGASVSFGLFVLSWVLLRLIYFPFWIIWSTSNYE

Seg: seg
233-242 seg

GGISSLLXGL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox