PRGDB00074258 (Ppa.17538)

From PRG Wiki
Jump to: navigation, search
Ppa.17538
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 208394096 (DC957177)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Physcomitrella patens

Comment?

DC957177 ppgs full-length cDNA library; green sporophytes Physcomitrella patens subsp. patens cDNA clone ppgs23k11 3', mRNA sequence

DNA Sequence

GTGTCGAGCAAAACATGACATGGAAGGAAAGTGTTAAAAACACTAATCACAAACAGTGATGTACCTAACCATTCTGTTACACAGCAACTGAAGCCCACCTGTCCATTCGTCTTCACTAAATTTTGCGGACAATTCTGCGAAAAGCTTCGATTAAACATCCTTGTGTGAAGAGAGATAAGACTTCCAGCGGGATGCCTCGATGCTCCAACTCTAAACCCTAACCCTaaaaaatgtaaaaagaaaaCACCGTACAAACAAACCTCTTTTGAAACGGATGTTGTACTTAATGAGACAAGGAGCTCCATCGAGCTGGCACTCGGAGCTACTTTATCTTACTTGGGTTCAGGCATTCGTGGCGTGTAGCCCCCGCTATACTTGAAGTTTGATGAAGAATTGGGCATCTTGTCGAAGTTTTCGGTCTCTCCATACTGCGCGTCATCGCCATACACATCGTTTAACCAGGTTGTATCTGTGGCAAGAGCACTGGCTTTGGCCTTAGGTTTGTTGCGTTGAGCGATGGCTTCGAGCTCTTTCACAACCTCGTTCATTGTAGGGCGATCCGCACCCCTTTCTTCCACGCAGTCGAGTGCTAGGTCAAGGAATTTCTTCAGGTCTTCTCGAGAGGCCTCGAGCACACAGGGATCCAGCAAAGGTTCGAGAGCATCCATGCCGCCTTTGTCTAAGGCAGTTCGGACTTCACGCACGATGTACTTGCCGTGTTCGATTGGTGCGCGAGATGTCAGTAGTTCCAAGAGAACCACACCGAAAGCGTAGACGTCGCTCTTATCCGAGAGATGCTGCGTCATGTAGTACTCGGGATCGAGATAGCCCATTGTTCCTTTCACTTGAGTGGTGGCAATCTTCTTGTCCGCTCCCTCCGGTGCTAATTTAGAAAGCCCAAAGTCTGCCACCTTCGCGACGTGGTTGCCATCTAGCAAGATGTTAGCCGACTAATATCACGATGGATAATCGGCGGGTTGGCCATCTCATGCAAAT


Protein sequences

Name Description Sequence
Ppa.17538 translated coding region predicted by ESTScan from UniGene Ppa.17538

XLHEMANPPIIHRDIXSANILLDGNHVAKVADFGLSKLAPEGADKKIATTQVKGTMGYLDPEYYMTQHLSDKSDVYAFGVVLLELLTSRAPIEHGKYIVREVRTALDKGGMDALEPLLDPCVLEASREDLKKFLDLALDCVEERGADRPTMNEVVKELEAIAQRNKPKAKASALATDTTWLNDVYGDDAQYGETENFDKMPNSSSNFKYSGGYTPRMPEPK

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-161 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XLHEMANPPIIHRDIXSANILLDGNHVAKVADFGLSKLAPEGADKKIATTQVKGTMGYLDPEYYMTQHLSDKSDVYAFGVVLLELLTSRAPIEHGKYIVREVRTALDKGGMDALEPLLDPCVLEASREDLKKFLDLALDCVEERGADRPTMNEVVKELEAI

HMMSmart: SM00220
IPR002290
1-161 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XLHEMANPPIIHRDIXSANILLDGNHVAKVADFGLSKLAPEGADKKIATTQVKGTMGYLDPEYYMTQHLSDKSDVYAFGVVLLELLTSRAPIEHGKYIVREVRTALDKGGMDALEPLLDPCVLEASREDLKKFLDLALDCVEERGADRPTMNEVVKELEAI

HMMPfam: PF00069
IPR017442
2-156 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LHEMANPPIIHRDIXSANILLDGNHVAKVADFGLSKLAPEGADKKIATTQVKGTMGYLDPEYYMTQHLSDKSDVYAFGVVLLELLTSRAPIEHGKYIVREVRTALDKGGMDALEPLLDPCVLEASREDLKKFLDLALDCVEERGADRPTMNEVVK

HMMPanther: PTHR24420:SF476
2-163 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LHEMANPPIIHRDIXSANILLDGNHVAKVADFGLSKLAPEGADKKIATTQVKGTMGYLDPEYYMTQHLSDKSDVYAFGVVLLELLTSRAPIEHGKYIVREVRTALDKGGMDALEPLLDPCVLEASREDLKKFLDLALDCVEERGADRPTMNEVVKELEAIAQ

HMMPanther: PTHR24420
2-163 FAMILY NOT NAMED,FAMILY NOT NAMED

LHEMANPPIIHRDIXSANILLDGNHVAKVADFGLSKLAPEGADKKIATTQVKGTMGYLDPEYYMTQHLSDKSDVYAFGVVLLELLTSRAPIEHGKYIVREVRTALDKGGMDALEPLLDPCVLEASREDLKKFLDLALDCVEERGADRPTMNEVVKELEAIAQ

Gene3D: G3DSA:1.10.510.10
2-169 no description

LHEMANPPIIHRDIXSANILLDGNHVAKVADFGLSKLAPEGADKKIATTQVKGTMGYLDPEYYMTQHLSDKSDVYAFGVVLLELLTSRAPIEHGKYIVREVRTALDKGGMDALEPLLDPCVLEASREDLKKFLDLALDCVEERGADRPTMNEVVKELEAIAQRNKPKA

superfamily: SSF56112
IPR011009
2-187 Protein kinase-like (PK-like)
Protein kinase-like domain

LHEMANPPIIHRDIXSANILLDGNHVAKVADFGLSKLAPEGADKKIATTQVKGTMGYLDPEYYMTQHLSDKSDVYAFGVVLLELLTSRAPIEHGKYIVREVRTALDKGGMDALEPLLDPCVLEASREDLKKFLDLALDCVEERGADRPTMNEVVKELEAIAQRNKPKAKASALATDTTWLNDVYGD

HMMSmart: SM00219
IPR020635
2-158 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LHEMANPPIIHRDIXSANILLDGNHVAKVADFGLSKLAPEGADKKIATTQVKGTMGYLDPEYYMTQHLSDKSDVYAFGVVLLELLTSRAPIEHGKYIVREVRTALDKGGMDALEPLLDPCVLEASREDLKKFLDLALDCVEERGADRPTMNEVVKEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox