PRGDB00074261 (Ppa.17590)

From PRG Wiki
Jump to: navigation, search
Ppa.17590
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 168011130 (XM_001758205)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Physcomitrella patens

Comment?

Physcomitrella patens subsp. patens predicted protein (PHYPADRAFT_22641) mRNA, partial cds

DNA Sequence

ACAGGAACCTTGCTGTATTATGCAAGTAAAGGCAACGTACCAATATTAAAGCATATGCTGGACAATGGCACGTCAGTGGATGCGGTAGATTATGACGGGCGAACTGCACTTCACCTTGCTGCTAGTGAAGGGCATACGGCTGCTGTGAAGTTGCTGCTTGAATATGGCTCGAGCGTGAATCCCTGCGACCGCTTTAATGAAACTCCATTAGCGAATGCGCGCAGATATGGGTACGAAGAGATCTGCGATTTACTAGTAGCGAGCGGTGGTTTTGTTAAGGTACGCAATTCTTTGGCTGTAGTATTGCCAATAAGTACGCTTTCTGAGTATGAAATCGATCCTGCGGAGTTGAGTTTGGAGAAAGCTCGATCTGTTGGCAAGGGTGCCTTTGGGGAGATCAAAATTGTGAAATGGCGTGGAACTGTAGTGGCAGCAAAGACCATATTGAGTCATTTGACATCAGATCAGAAAATAGTGAAAGAGTTTGTTGATGAGCTGGCTCTCCTTTCAAGACTGCGGCATCCAAACATCATGCAGTTTCTTGGTGCTGTAACCAAAACTCAACCCTTTATTATAGTAACCGAGTATCTTCCAAAGGGAGATTTACATGATTACCTTGATCGGAAAGGAAAGCTCGATGCATTGACTGCTGTGAAATTTGCCCTCGACATCGCCAAGGGTATGAATTATCTTCATGAACACAAACCCGATCCTATCGTACATCGTGATCTAAAGCCCAGGAATTTGTTGTTACATGAAGCTGGATATCTCAAAGTGGCAGATTTCGGACTTGGTAAGCTTCTAGATGCTTCTGAGGCTACGAAGCAATACTTAATGACTGGAGAAACTGGATCCTATCGGTACATGGCTCCGGAGGTGTTTCTACACAAAGCTTATGATAAGAGTGTGGATGTGTTCTCTTTTGCTATCATTGTTCATGAGTTATTCGAAGGAGGCCCACATTCGAAGTTTCAGGGGGCCAAAGACATTGCTCATTTTAGAGCGAAGGAAGGGAAGAGGCCATCTTTCGTTGTAAATACGTATCCTTCTCGTATGAAAGACTTGCTGAAGCAGTGTTGGCATCAGGACCCCACGAAGCGGCCCAGCTTTGCAACTATCATCGTGCATCTGGAGGGTATT


Protein sequences

Name Description Sequence
Ppa.17590 translated coding region predicted by ESTScan from UniGene Ppa.17590

TGTLLYYASKGNVPILKHMLDNGTSVDAVDYDGRTALHLAASEGHTAAVKLLLEYGSSVNPCDRFNETPLANARRYGYEEICDLLVASGGFVKVRNSLAVVLPISTLSEYEIDPAELSLEKARSVGKGAFGEIKIVKWRGTVVAAKTILSHLTSDQKIVKEFVDELALLSRLRHPNIMQFLGAVTKTQPFIIVTEYLPKGDLHDYLDRKGKLDALTAVKFALDIAKGMNYLHEHKPDPIVHRDLKPRNLLLHEAGYLKVADFGLGKLLDASEATKQYLMTGETGSYRYMAPEVFLHKAYDKSVDVFSFAIIVHELFEGGPHSKFQGAKDIAHFRAKEGKRPSFVVNTYPSRMKDLLKQCWHQDPTKRPSFATIIVHLEGI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50297
IPR020683
1-97 ANK_REP_REGION
Ankyrin repeat-containing domain

TGTLLYYASKGNVPILKHMLDNGTSVDAVDYDGRTALHLAASEGHTAAVKLLLEYGSSVNPCDRFNETPLANARRYGYEEICDLLVASGGFVKVRNS

superfamily: SSF48403
IPR020683
4-86 ANK
Ankyrin repeat-containing domain

LLYYASKGNVPILKHMLDNGTSVDAVDYDGRTALHLAASEGHTAAVKLLLEYGSSVNPCDRFNETPLANARRYGYEEICDLLV

HMMSmart: SM00248
IPR002110
4-28 ANK
Ankyrin repeat

LLYYASKGNVPILKHMLDNGTSVDA

Gene3D: G3DSA:1.25.40.20
IPR020683
4-96 ANK
Ankyrin repeat-containing domain

LLYYASKGNVPILKHMLDNGTSVDAVDYDGRTALHLAASEGHTAAVKLLLEYGSSVNPCDRFNETPLANARRYGYEEICDLLVASGGFVKVRN

HMMPfam: PF12796
IPR020683
4-90 Ank_2,Ankyrin repeats (3 copies)
Ankyrin repeat-containing domain

LLYYASKGNVPILKHMLDNGTSVDAVDYDGRTALHLAASEGHTAAVKLLLEYGSSVNPCDRFNETPLANARRYGYEEICDLLVASGG

HMMPanther: PTHR23257:SF89
19-380 PTHR23257:SF89,ANKYRIN-KINASE

MLDNGTSVDAVDYDGRTALHLAASEGHTAAVKLLLEYGSSVNPCDRFNETPLANARRYGYEEICDLLVASGGFVKVRNSLAVVLPISTLSEYEIDPAELSLEKARSVGKGAFGEIKIVKWRGTVVAAKTILSHLTSDQKIVKEFVDELALLSRLRHPNIMQFLGAVTKTQPFIIVTEYLPKGDLHDYLDRKGKLDALTAVKFALDIAKGMNYLHEHKPDPIVHRDLKPRNLLLHEAGYLKVADFGLGKLLDASEATKQYLMTGETGSYRYMAPEVFLHKAYDKSVDVFSFAIIVHELFEGGPHSKFQGAKDIAHFRAKEGKRPSFVVNTYPSRMKDLLKQCWHQDPTKRPSFATIIVHLEGI

HMMPanther: PTHR23257
19-380 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

MLDNGTSVDAVDYDGRTALHLAASEGHTAAVKLLLEYGSSVNPCDRFNETPLANARRYGYEEICDLLVASGGFVKVRNSLAVVLPISTLSEYEIDPAELSLEKARSVGKGAFGEIKIVKWRGTVVAAKTILSHLTSDQKIVKEFVDELALLSRLRHPNIMQFLGAVTKTQPFIIVTEYLPKGDLHDYLDRKGKLDALTAVKFALDIAKGMNYLHEHKPDPIVHRDLKPRNLLLHEAGYLKVADFGLGKLLDASEATKQYLMTGETGSYRYMAPEVFLHKAYDKSVDVFSFAIIVHELFEGGPHSKFQGAKDIAHFRAKEGKRPSFVVNTYPSRMKDLLKQCWHQDPTKRPSFATIIVHLEGI

HMMSmart: SM00248
IPR002110
32-61 ANK
Ankyrin repeat

DGRTALHLAASEGHTAAVKLLLEYGSSVNP

ProfileScan: PS50088
IPR002110
32-64 ANK_REPEAT
Ankyrin repeat

DGRTALHLAASEGHTAAVKLLLEYGSSVNPCDR

HMMSmart: SM00248
IPR002110
65-94 ANK
Ankyrin repeat

FNETPLANARRYGYEEICDLLVASGGFVKV

superfamily: SSF56112
IPR011009
89-377 Kinase_like
Protein kinase-like domain

GGFVKVRNSLAVVLPISTLSEYEIDPAELSLEKARSVGKGAFGEIKIVKWRGTVVAAKTILSHLTSDQKIVKEFVDELALLSRLRHPNIMQFLGAVTKTQPFIIVTEYLPKGDLHDYLDRKGKLDALTAVKFALDIAKGMNYLHEHKPDPIVHRDLKPRNLLLHEAGYLKVADFGLGKLLDASEATKQYLMTGETGSYRYMAPEVFLHKAYDKSVDVFSFAIIVHELFEGGPHSKFQGAKDIAHFRAKEGKRPSFVVNTYPSRMKDLLKQCWHQDPTKRPSFATIIVHL

Gene3D: G3DSA:3.30.200.20
105-182 G3DSA:3.30.200.20

STLSEYEIDPAELSLEKARSVGKGAFGEIKIVKWRGTVVAAKTILSHLTSDQKIVKEFVDELALLSRLRHPNIMQFLG

ProfileScan: PS50011
IPR000719
119-379 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LEKARSVGKGAFGEIKIVKWRGTVVAAKTILSHLTSDQKIVKEFVDELALLSRLRHPNIMQFLGAVTKTQPFIIVTEYLPKGDLHDYLDRKGKLDALTAVKFALDIAKGMNYLHEHKPDPIVHRDLKPRNLLLHEAGYLKVADFGLGKLLDASEATKQYLMTGETGSYRYMAPEVFLHKAYDKSVDVFSFAIIVHELFEGGPHSKFQGAKDIAHFRAKEGKRPSFVVNTYPSRMKDLLKQCWHQDPTKRPSFATIIVHLEG

HMMPfam: PF00069
IPR017442
120-376 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EKARSVGKGAFGEIKIVKWRGTVVAAKTILSHLTSDQKIVKEFVDELALLSRLRHPNIMQFLGAVTKTQPFIIVTEYLPKGDLHDYLDRKGKLDALTAVKFALDIAKGMNYLHEHKPDPIVHRDLKPRNLLLHEAGYLKVADFGLGKLLDASEATKQYLMTGETGSYRYMAPEVFLHKAYDKSVDVFSFAIIVHELFEGGPHSKFQGAKDIAHFRAKEGKRPSFVVNTYPSRMKDLLKQCWHQDPTKRPSFATIIVH

PatternScan: PS00107
IPR017441
125-146 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGKGAFGEIKIVKWRGTVVAAK

Gene3D: G3DSA:1.10.510.10
183-376 G3DSA:1.10.510.10

AVTKTQPFIIVTEYLPKGDLHDYLDRKGKLDALTAVKFALDIAKGMNYLHEHKPDPIVHRDLKPRNLLLHEAGYLKVADFGLGKLLDASEATKQYLMTGETGSYRYMAPEVFLHKAYDKSVDVFSFAIIVHELFEGGPHSKFQGAKDIAHFRAKEGKRPSFVVNTYPSRMKDLLKQCWHQDPTKRPSFATIIVH

FPrintScan: PR00109
IPR001245
194-207 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEYLPKGDLHDYLD

FPrintScan: PR00109
IPR001245
233-251 TYRKINASE
Serine-threonine/tyrosine-protein kinase

EHKPDPIVHRDLKPRNLLL

PatternScan: PS00108
IPR008271
239-251 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKPRNLLL

FPrintScan: PR00109
IPR001245
303-325 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VDVFSFAIIVHELFEGGPHSKFQ

FPrintScan: PR00109
IPR001245
348-370 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YPSRMKDLLKQCWHQDPTKRPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox