PRGDB00074263 (Ppa.17804)

From PRG Wiki
Jump to: navigation, search
Ppa.17804
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 168052599 (XM_001778676)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Physcomitrella patens

Comment?

Physcomitrella patens subsp. patens predicted protein (PHYPADRAFT_195649) mRNA, complete cds

DNA Sequence

ATGTTGTTGACTTTGTGGCGCAGGCAATTGTACAATAACAATATGACTGGCCCGATTCCTCCGGAAATTGGACTGCTCACGAGATTGAATTCTCTGTCGCTCGGCACAAACGGTTTCTCGGGGACGATTCCTCGTGAGCTTGGCAATCTGCAAGCTCTACAACTATTGCATTTGGACAGTAATCAACTGAATGGAACAATCCCTTCCGAGATTGGCACCATTCAAACCGTGAGACAGTTATGGCTGTCGGACAACAATCTTTCAGGTCCAATACCTGATGTGTTTGGGAACTTCACAGGGCTTCTTGAAGTAAGAATTCATGGAAATCCACTTCTACAGGGTCCTATTCCAAGCAGTTTGTTCAATTCTCCCTCCATAGAAGCAATATACATTGGCGAATTGTCGGAAGGGAAAGCGTTGCCAGCCACATTTACAACACCTCTGTCGAATTTATCTGTATTGTATTTGCGAAATTGCCGACTTACTGGATCAATCCCCAGCACAATAAACATGCTGTCAAAACTGCAGTACTTAGATTTGAGTTTCAACAATTTATCAGGCGAAATACCGTCACAGCTGTCAGAAATCACCAGTTTGAAGACCTTGTACCTTGGAAGCAACTCGTTGACAGGTCGTCTACCCGAGGGTCTTGGGGCACTGAGTTTCTTGACAGAAGTGGATGTGTCGTATAATTTTCTCAATGGTACTCTTCCATCATGGGTTGACAAACCCACAGTTACAACGTACGCCACCAACTCGGCTCTCGGACAGAATGACTGCTGTGCTAAGTTTCTTTCAACTGCAAGTGATTGGAATTTAGTTTTTGGGACTAATGTGCGAAGCGGGCTGGCTACAGTCACCAGCTTGGCAGTGAATGTGGGGGGTTCAGTGCATGGAAAATACGAAGAGGATACGGCAACACTGGGGTCAACAGCCTTCGCTGCAAAAAAACATTGGGCAGCGAGTAGCACAGGATTTGTGCCAGGCGCTAGCTTCACTAGCCTTGTAAAATCAGGTACTCCTGTTTCGGGAACGGCGGATCAAACAGTTTACGCAACGGCACGGACGTCGCTTGGGTCCCTCAGGTACTACGCTACCCAGCTGCGAAATGGAGACTACAACGTGGTTCTATCCTTCGCTGAGATAGTGTATACACGTGACGACAATCTTGCACGACGAGTTTTTGATATATACTTGCAGGGGCAGTTGATGAAGAAAGATTTCGACATAGGTGAGACGGCAGGAGGATCATTCGTGGCGCATGAAGAGAAATTCCAAGTCGCGGTGACTACTGGAGTGCTGGACATTCATTTGTTCTACGCAGGGAAGGGCACCTGCTGCCTCCCGCAACCTTCGAATTGGTCATTTGGTCCTCTTTTGTCAGCCATCTCTGTTGATAATGTGTTGAGCGGAGGCCAAACTCAAGTTTCAGGGGGAAAGAATAGCAAGGGTTCATCAGTGGGTTTGATTGTTGGCCTCACTGTAGCAGCAATCGTTTTGGTGATCTTGGTTTTATGCTGTATTTGCGGGCTTGTGGTGCGACGGAGAAAGAACAGGACAACATTACGCCTTGAGGATCAACTTGAGATTCAAAAATTCCAAGTGCAACCGAACCTCTTTAGCTACGCTGAACTCAAAGCAGCAACAAGGTCATTCGATCCAGGCAACAAACTTGGCGAAGGAGGCTATGGAGTCGTATACAAAGGAGTACTAGCGGATGGGACGGAAGTTGCCGTGAAGACGTTGTCTGCCAAGTCTTACCAGGGGAAGCATGAGTTTCTGAACGAAGCCGCACTAATCACAGCTGTGCAACACCGCAGTCTCGTGAAGTTGAAAGGATGCTGTCTGGAGCGAGACCATCGCATCTTGGTCTATGAGTTCATGGAAAATAAGAGCCTCCATCAGACTTTGTTCGGAGCAAGAGCGATGCCCATGGATTGGCCAACAAGATTTATCATCGCTCTAGGAACCGCGCGAGGGTTAGCATACCTGCACGAGGAGTCAGAGGCACGTATTGTGCATCGGGACATCAAGGCGAGCAACATTCTCTTGGACCGGAACTTCAACCCCAAGATAGCCGACTTCGGAATGGCTCGCTTATTTGAGGATCACCAAAGTCATGTCAGCACTCGAGTTGCGGGAACACTGGGTTATGTGGCACCAGAGTACGCATTACTGGGTCAGTTGACAGAGAAGGCAGATGTGTTTAGTTACGGCATTGTGTTGCTTGAACTAGTGAGCGGAAGGTTCAACATTAGGACTGACATTCGTGGAGAGCAAGCATACCTTCTCGAATGGGCTTGGAAACTTGAAGCGGAGGATAACTTATTATACGTGATGGATGGAAAACTCTTGGATACGTACGTGGAAGACGAGGTTCTGAGAGTTCTTCATGTGGCACTGTTGTGCACACAAGCGGTAGCGTCAACCCGGCCATGCATGACTCGTGTAGTAGCCATGTTGCTGGGCGACATAGAACTTCCTCCCATCACTTCAGGCCCAGGGTTTATGGTGGGTTTGATGCACTCCGAAACACCGTCACATTCAACCAGCTCATCGTTCTTAACAAACTCAAGTGGCTTTCGCGGAAAAGAATCGGCTCCTCTGATTCAGCTGAGCGAAACCCGCACGAAGACAGATATGGAAATGTATCCTAGATGATCAATATGCGCTGAAACTGGCTAAAAAATGTCATGCTACATAGAGTGTTGGTTCAAACGAAGCGACTGTAGTTTTTTTGATAGTCAGTAATTTTTCAGTCTAATTCGTTCACGATTGAACTAGACAAATAGTAGTTAGTTGGCAATTTGTTGACTGCCCAGCATTCACCTGCACAGAGGGCTACTGCCATTGAATAGGTGTTTCCAAAATGGTAATGCCTTCGTAACAAACATTCCTCTCCTCTTGATGCCTAAACTGGCGAATTTGACACAAATGAAATCTGCCTTCGAAGTTCA


Protein sequences

Name Description Sequence
Ppa.17804 translated coding region predicted by ESTScan from UniGene Ppa.17804

MLLTLWRRQLYNNNMTGPIPPEIGLLTRLNSLSLGTNGFSGTIPRELGNLQALQLLHLDSNQLNGTIPSEIGTIQTVRQLWLSDNNLSGPIPDVFGNFTGLLEVRIHGNPLLQGPIPSSLFNSPSIEAIYIGELSEGKALPATFTTPLSNLSVLYLRNCRLTGSIPSTINMLSKLQYLDLSFNNLSGEIPSQLSEITSLKTLYLGSNSLTGRLPEGLGALSFLTEVDVSYNFLNGTLPSWVDKPTVTTYATNSALGQNDCCAKFLSTASDWNLVFGTNVRSGLATVTSLAVNVGGSVHGKYEEDTATLGSTAFAAKKHWAASSTGFVPGASFTSLVKSGTPVSGTADQTVYATARTSLGSLRYYATQLRNGDYNVVLSFAEIVYTRDDNLARRVFDIYLQGQLMKKDFDIGETAGGSFVAHEEKFQVAVTTGVLDIHLFYAGKGTCCLPQPSNWSFGPLLSAISVDNVLSGGQTQVSGGKNSKGSSVGLIVGLTVAAIVLVILVLCCICGLVVRRRKNRTTLRLEDQLEIQKFQVQPNLFSYAELKAATRSFDPGNKLGEGGYGVVYKGVLADGTEVAVKTLSAKSYQGKHEFLNEAALITAVQHRSLVKLKGCCLERDHRILVYEFMENKSLHQTLFGARAMPMDWPTRFIIALGTARGLAYLHEESEARIVHRDIKASNILLDRNFNPKIADFGMARLFEDHQSHVSTRVAGTLGYVAPEYALLGQLTEKADVFSYGIVLLELVSGRFNIRTDIRGEQAYLLEWAWKLEAEDNLLYVMDGKLLDTYVEDEVLRVLHVALLCTQAVASTRPCMTRVVAMLLGDIELPPITSGPGFMVGLMHSETPSHSTSSSFLTNSSGFRGKESAPLIQLSETRTKTDMEMYPRXSICAETG

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
9-244 no description

QLYNNNMTGPIPPEIGLLTRLNSLSLGTNGFSGTIPRELGNLQALQLLHLDSNQLNGTIPSEIGTIQTVRQLWLSDNNLSGPIPDVFGNFTGLLEVRIHGNPLLQGPIPSSLFNSPSIEAIYIGELSEGKALPATFTTPLSNLSVLYLRNCRLTGSIPSTINMLSKLQYLDLSFNNLSGEIPSQLSEITSLKTLYLGSNSLTGRLPEGLGALSFLTEVDVSYNFLNGTLPSWVDKP

superfamily: SSF52058
10-243 L domain-like,LRR

LYNNNMTGPIPPEIGLLTRLNSLSLGTNGFSGTIPRELGNLQALQLLHLDSNQLNGTIPSEIGTIQTVRQLWLSDNNLSGPIPDVFGNFTGLLEVRIHGNPLLQGPIPSSLFNSPSIEAIYIGELSEGKALPATFTTPLSNLSVLYLRNCRLTGSIPSTINMLSKLQYLDLSFNNLSGEIPSQLSEITSLKTLYLGSNSLTGRLPEGLGALSFLTEVDVSYNFLNGTLPSWVDK

HMMPanther: PTHR24420:SF469
13-893 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

NNMTGPIPPEIGLLTRLNSLSLGTNGFSGTIPRELGNLQALQLLHLDSNQLNGTIPSEIGTIQTVRQLWLSDNNLSGPIPDVFGNFTGLLEVRIHGNPLLQGPIPSSLFNSPSIEAIYIGELSEGKALPATFTTPLSNLSVLYLRNCRLTGSIPSTINMLSKLQYLDLSFNNLSGEIPSQLSEITSLKTLYLGSNSLTGRLPEGLGALSFLTEVDVSYNFLNGTLPSWVDKPTVTTYATNSALGQNDCCAKFLSTASDWNLVFGTNVRSGLATVTSLAVNVGGSVHGKYEEDTATLGSTAFAAKKHWAASSTGFVPGASFTSLVKSGTPVSGTADQTVYATARTSLGSLRYYATQLRNGDYNVVLSFAEIVYTRDDNLARRVFDIYLQGQLMKKDFDIGETAGGSFVAHEEKFQVAVTTGVLDIHLFYAGKGTCCLPQPSNWSFGPLLSAISVDNVLSGGQTQVSGGKNSKGSSVGLIVGLTVAAIVLVILVLCCICGLVVRRRKNRTTLRLEDQLEIQKFQVQPNLFSYAELKAATRSFDPGNKLGEGGYGVVYKGVLADGTEVAVKTLSAKSYQGKHEFLNEAALITAVQHRSLVKLKGCCLERDHRILVYEFMENKSLHQTLFGARAMPMDWPTRFIIALGTARGLAYLHEESEARIVHRDIKASNILLDRNFNPKIADFGMARLFEDHQSHVSTRVAGTLGYVAPEYALLGQLTEKADVFSYGIVLLELVSGRFNIRTDIRGEQAYLLEWAWKLEAEDNLLYVMDGKLLDTYVEDEVLRVLHVALLCTQAVASTRPCMTRVVAMLLGDIELPPITSGPGFMVGLMHSETPSHSTSSSFLTNSSGFRGKESAPLIQLSETRTKTDMEMYPRXSICAET

HMMPanther: PTHR24420
13-893 FAMILY NOT NAMED,FAMILY NOT NAMED

NNMTGPIPPEIGLLTRLNSLSLGTNGFSGTIPRELGNLQALQLLHLDSNQLNGTIPSEIGTIQTVRQLWLSDNNLSGPIPDVFGNFTGLLEVRIHGNPLLQGPIPSSLFNSPSIEAIYIGELSEGKALPATFTTPLSNLSVLYLRNCRLTGSIPSTINMLSKLQYLDLSFNNLSGEIPSQLSEITSLKTLYLGSNSLTGRLPEGLGALSFLTEVDVSYNFLNGTLPSWVDKPTVTTYATNSALGQNDCCAKFLSTASDWNLVFGTNVRSGLATVTSLAVNVGGSVHGKYEEDTATLGSTAFAAKKHWAASSTGFVPGASFTSLVKSGTPVSGTADQTVYATARTSLGSLRYYATQLRNGDYNVVLSFAEIVYTRDDNLARRVFDIYLQGQLMKKDFDIGETAGGSFVAHEEKFQVAVTTGVLDIHLFYAGKGTCCLPQPSNWSFGPLLSAISVDNVLSGGQTQVSGGKNSKGSSVGLIVGLTVAAIVLVILVLCCICGLVVRRRKNRTTLRLEDQLEIQKFQVQPNLFSYAELKAATRSFDPGNKLGEGGYGVVYKGVLADGTEVAVKTLSAKSYQGKHEFLNEAALITAVQHRSLVKLKGCCLERDHRILVYEFMENKSLHQTLFGARAMPMDWPTRFIIALGTARGLAYLHEESEARIVHRDIKASNILLDRNFNPKIADFGMARLFEDHQSHVSTRVAGTLGYVAPEYALLGQLTEKADVFSYGIVLLELVSGRFNIRTDIRGEQAYLLEWAWKLEAEDNLLYVMDGKLLDTYVEDEVLRVLHVALLCTQAVASTRPCMTRVVAMLLGDIELPPITSGPGFMVGLMHSETPSHSTSSSFLTNSSGFRGKESAPLIQLSETRTKTDMEMYPRXSICAET

Seg: seg
47-58 seg

LGNLQALQLLHL

HMMSmart: SM00369
IPR003591
50-74 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQALQLLHLDSNQLNGTIPSEIGTI

HMMSmart: SM00369
IPR003591
148-171 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLSVLYLRNCRLTGSIPSTINM

HMMPfam: PF13855
149-209 LRR_8,Leucine rich repeat

SNLSVLYLRNCRLTGSIPSTINMLSKLQYLDLSFNNLSGEIPSQLSEITSLKTLYLGSNSL

HMMSmart: SM00369
IPR003591
172-195 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSKLQYLDLSFNNLSGEIPSQLSE

HMMSmart: SM00369
IPR003591
196-220 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

ITSLKTLYLGSNSLTGRLPEGLGAL

HMMPfam: PF11721
IPR021720
288-463 Malectin
Malectin

SLAVNVGGSVHGKYEEDTATLGSTAFAAKKHWAASSTGFVPGASFTSLVKSGTPVSGTADQTVYATARTSLGSLRYYATQLRNGDYNVVLSFAEIVYTRDDNLARRVFDIYLQGQLMKKDFDIGETAGGSFVAHEEKFQVAVTTGVLDIHLFYAGKGTCCLPQPSNWSFGPLLSAI

Seg: seg
476-488 seg

VSGGKNSKGSSVG

Seg: seg
489-513 seg

LIVGLTVAAIVLVILVLCCICGLVV

Gene3D: G3DSA:3.30.200.20
534-614 no description

QVQPNLFSYAELKAATRSFDPGNKLGEGGYGVVYKGVLADGTEVAVKTLSAKSYQGKHEFLNEAALITAVQHRSLVKLKGC

superfamily: SSF56112
IPR011009
538-852 Protein kinase-like (PK-like)
Protein kinase-like domain

NLFSYAELKAATRSFDPGNKLGEGGYGVVYKGVLADGTEVAVKTLSAKSYQGKHEFLNEAALITAVQHRSLVKLKGCCLERDHRILVYEFMENKSLHQTLFGARAMPMDWPTRFIIALGTARGLAYLHEESEARIVHRDIKASNILLDRNFNPKIADFGMARLFEDHQSHVSTRVAGTLGYVAPEYALLGQLTEKADVFSYGIVLLELVSGRFNIRTDIRGEQAYLLEWAWKLEAEDNLLYVMDGKLLDTYVEDEVLRVLHVALLCTQAVASTRPCMTRVVAMLLGDIELPPITSGPGFMVGLMHSETPSHSTSS

ProfileScan: PS50011
IPR000719
552-827 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDPGNKLGEGGYGVVYKGVLADGTEVAVKTLSAKSYQGKHEFLNEAALITAVQHRSLVKLKGCCLERDHRILVYEFMENKSLHQTLFGARAMPMDWPTRFIIALGTARGLAYLHEESEARIVHRDIKASNILLDRNFNPKIADFGMARLFEDHQSHVSTRVAGTLGYVAPEYALLGQLTEKADVFSYGIVLLELVSGRFNIRTDIRGEQAYLLEWAWKLEAEDNLLYVMDGKLLDTYVEDEVLRVLHVALLCTQAVASTRPCMTRVVAMLLGDIEL

HMMSmart: SM00219
IPR020635
552-821 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDPGNKLGEGGYGVVYKGVLADGTEVAVKTLSAKSYQGKHEFLNEAALITAVQHRSLVKLKGCCLERDHRILVYEFMENKSLHQTLFGARAMPMDWPTRFIIALGTARGLAYLHEESEARIVHRDIKASNILLDRNFNPKIADFGMARLFEDHQSHVSTRVAGTLGYVAPEYALLGQLTEKADVFSYGIVLLELVSGRFNIRTDIRGEQAYLLEWAWKLEAEDNLLYVMDGKLLDTYVEDEVLRVLHVALLCTQAVASTRPCMTRVVAML

HMMSmart: SM00220
IPR002290
552-830 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDPGNKLGEGGYGVVYKGVLADGTEVAVKTLSAKSYQGKHEFLNEAALITAVQHRSLVKLKGCCLERDHRILVYEFMENKSLHQTLFGARAMPMDWPTRFIIALGTARGLAYLHEESEARIVHRDIKASNILLDRNFNPKIADFGMARLFEDHQSHVSTRVAGTLGYVAPEYALLGQLTEKADVFSYGIVLLELVSGRFNIRTDIRGEQAYLLEWAWKLEAEDNLLYVMDGKLLDTYVEDEVLRVLHVALLCTQAVASTRPCMTRVVAMLLGDIELPPI

HMMPfam: PF00069
IPR017442
555-760 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GNKLGEGGYGVVYKGVLADGTEVAVKTLSAKSYQGKHEFLNEAALITAVQHRSLVKLKGCCLERDHRILVYEFMENKSLHQTLFGARAMPMDWPTRFIIALGTARGLAYLHEESEARIVHRDIKASNILLDRNFNPKIADFGMARLFEDHQSHVSTRVAGTLGYVAPEYALLGQLTEKADVFSYGIVLLELVSGRFNIRTDIRGEQ

Seg: seg
557-571 seg

KLGEGGYGVVYKGVL

PatternScan: PS00107
IPR017441
558-580 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGYGVVYKGVLADGTEVAVK

Gene3D: G3DSA:1.10.510.10
615-754 no description

CLERDHRILVYEFMENKSLHQTLFGARAMPMDWPTRFIIALGTARGLAYLHEESEARIVHRDIKASNILLDRNFNPKIADFGMARLFEDHQSHVSTRVAGTLGYVAPEYALLGQLTEKADVFSYGIVLLELVSGRFNIRT

PatternScan: PS00108
IPR008271
672-684 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKASNILL

Seg: seg
843-859 seg

SETPSHSTSSSFLTNSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox