PRGDB00074266 (Ppa.18449)

From PRG Wiki
Jump to: navigation, search
Ppa.18449
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 162257533 (FC433667)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Physcomitrella patens

Comment?

CBAW420.rev CBAW Physcomitrella patens subsp. patens Gransden - dessicated (H) Physcomitrella patens subsp. patens cDNA clone CBAW420 3', mRNA sequence

DNA Sequence

tttttttttttttttACCAGTATCCATTCTTATGATTCAAGAAGATTGAGATGTAATTAACAAGCTTTGGCCGTCATTCTCCTGCACCTGTTTGTCAAATGCCCACCATTCAACATTACCTTGTCCAAACCAAAGAAACTATGCAGAAAAGTGTGCATGCAACAGGCCCAATATCTCACAGCGCAAAACAAACAGCGATGCAGGATATATAGCCCCTCTGCAGCGTCATCATCTCGGAGATAGCACTGTTCCATTTGTGGAATATGCATTGGACGAGTGATCGGAAGAGCTCAGGAGATTTTGCTTGTGTGAGGACTCACGCTGGCCGCGAGACGAATGTTCAGTCTGAGAGCCTTCCAACATGATGGCGGTGCGGATCTCTCGAACCACTTCAGTCATGGTAGGTCTGTGGATAGATTTGGGTTCAACACTCCGCAAGGCGATCTCTACAAATCGCATCAGAGACTCCGGGTTGGGATTGGAGGCTCTTACGGCCGAGTCCAAGATTTTATCGAGGTTGTTACCAGTTTCCATAGTCATTCGAACCCATGAGCAGAGATTCCATTCGTCTCGGTTGGCAAGCTTGGGATTAATGGGTATCCGCCCAGTCAGCAATTCTAGAAGCACTACACCAAAGCTGAACACATCGCTTTTGAGGGTCAGCTTTTGAGTGTCGTAATACCTGCACGTGTACATTGAATTGTTCGCCTAGCATCACCTGTCAGCATAAAGCACTCGGACCAGAAGCTTCGAACTGGGGGTCAAGATACCCAGCTGTTCCTTTCACAAAGGTGGAAACATGCGTGGCATTCT


Protein sequences

Name Description Sequence
Ppa.18449 translated coding region predicted by ESTScan from UniGene Ppa.18449

XNATHVSTFVKGTAGYLDPQFEASGPSALCXQVMLGEQFNVHVQVYDTQKLTLKSDVFSFGVVLLELLTGRIPINPKLANRDEWNLCSWVRMTMETGNNLDKILDSAVRASNPNPESLMRFVEIALRSVEPKSIHRPTMTEVVREIRTAIMLEGSQTEHSSRGQRESSHKQNLLSSSDHSSNAYSTNGTVLSPR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-150 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XNATHVSTFVKGTAGYLDPQFEASGPSALCXQVMLGEQFNVHVQVYDTQKLTLKSDVFSFGVVLLELLTGRIPINPKLANRDEWNLCSWVRMTMETGNNLDKILDSAVRASNPNPESLMRFVEIALRSVEPKSIHRPTMTEVVREIRTAI

HMMPanther: PTHR24420
2-153 FAMILY NOT NAMED,FAMILY NOT NAMED

NATHVSTFVKGTAGYLDPQFEASGPSALCXQVMLGEQFNVHVQVYDTQKLTLKSDVFSFGVVLLELLTGRIPINPKLANRDEWNLCSWVRMTMETGNNLDKILDSAVRASNPNPESLMRFVEIALRSVEPKSIHRPTMTEVVREIRTAIMLE

superfamily: SSF56112
IPR011009
45-144 Protein kinase-like (PK-like)
Protein kinase-like domain

VYDTQKLTLKSDVFSFGVVLLELLTGRIPINPKLANRDEWNLCSWVRMTMETGNNLDKILDSAVRASNPNPESLMRFVEIALRSVEPKSIHRPTMTEVVR

Gene3D: G3DSA:1.10.510.10
45-182 no description

VYDTQKLTLKSDVFSFGVVLLELLTGRIPINPKLANRDEWNLCSWVRMTMETGNNLDKILDSAVRASNPNPESLMRFVEIALRSVEPKSIHRPTMTEVVREIRTAIMLEGSQTEHSSRGQRESSHKQNLLSSSDHSSN

HMMPfam: PF07714
IPR001245
46-145 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

YDTQKLTLKSDVFSFGVVLLELLTGRIPINPKLANRDEWNLCSWVRMTMETGNNLDKILDSAVRASNPNPESLMRFVEIALRSVEPKSIHRPTMTEVVRE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox