PRGDB00074267 (Ppa.18454)

From PRG Wiki
Jump to: navigation, search
Ppa.18454
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 162258035 (FC434129)
Gene Class Unknown
Domain Type
Gene Species Physcomitrella patens

Comment?

CBAW707.rev CBAW Physcomitrella patens subsp. patens Gransden - dessicated (H) Physcomitrella patens subsp. patens cDNA clone CBAW707 3', mRNA sequence

DNA Sequence

CAAATCCCGAAGAGAATAATTTATTTAAACCATCAGCATCATCATGTTCTAGGTTTCCATGGAAACCATCCGATGCCATCAAAATAACACAGGTTCCGTAAGCACGAACTCATATTGGTTTGGAACTCAAAGCTGGTTATGATTTCTAAAGCTCTCTATACAAATAGAAAAGGACAATTACCTGCGTTGGAAGTTGAAGCTTTTGAGGGCAAAAATAAATACCAACGCGAAAATGACCATCCACACGATGAGCATCGGGCCGACAACAGGCAAGAAGTCGTGTTCGAATCCAAATGTTTCCTTGAGATAATCCTTGACGATGATGTCTTTCGTCTCGTCGCCTACAATGATAAGCTTGTCCGTAACATCTCCGAACTGTGAAGCTATCAATGCATAAATGATCCAAGCTAAGGGACAAAGCCAGTAGTACCATATCCACCACCCGGGAATCGCAGGTCGTGGAATCAAGAATCCGGCGTAGAGATTGAAGAGCGTGGAGAAAAAAGCACTGACGATGGAGGCCAAGATAACATTGGGAGTAATGGCCACCATCATCATACCGTAATACGTGAACGACAGCAAGCTGATGATATTGGTGTAATAGTACCA


Protein sequences

Name Description Sequence
Ppa.18454 translated coding region predicted by ESTScan from UniGene Ppa.18454

WYYYTNIISLLSFTYYGMMMVAITPNVILASIVSAFFSTLFNLYAGFLIPRPAIPGWWIWYYWLCPLAWIIYALIASQFGDVTDKLIIVGDETKDIIVKDYLKETFGFEHDFLPVVGPMLIVWMVIFALVFIFALKSFNFQRR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF10
1-143 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

WYYYTNIISLLSFTYYGMMMVAITPNVILASIVSAFFSTLFNLYAGFLIPRPAIPGWWIWYYWLCPLAWIIYALIASQFGDVTDKLIIVGDETKDIIVKDYLKETFGFEHDFLPVVGPMLIVWMVIFALVFIFALKSFNFQRR

HMMPanther: PTHR19241
1-143 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

WYYYTNIISLLSFTYYGMMMVAITPNVILASIVSAFFSTLFNLYAGFLIPRPAIPGWWIWYYWLCPLAWIIYALIASQFGDVTDKLIIVGDETKDIIVKDYLKETFGFEHDFLPVVGPMLIVWMVIFALVFIFALKSFNFQRR

HMMPfam: PF01061
IPR013525
1-79 ABC2_membrane
ABC-2 type transporter

WYYYTNIISLLSFTYYGMMMVAITPNVILASIVSAFFSTLFNLYAGFLIPRPAIPGWWIWYYWLCPLAWIIYALIASQF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox