PRGDB00074269 (Ppa.18614)

From PRG Wiki
Jump to: navigation, search
Ppa.18614
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 208364886 (DC957909)
Gene Class Unknown
Domain Type
Gene Species Physcomitrella patens

Comment?

DC957909 ppgs full-length cDNA library; green sporophytes Physcomitrella patens subsp. patens cDNA clone ppgs2k05 3', mRNA sequence

DNA Sequence

TAAAATTTATACAAAGTTAAAGCCAATTCAGGGTAGATCGTACTTGATTTAGTCTAAAGATCATATTAAACTATTTCATTTGTTTGGCTTTTAGAAACATGACTAGATTGTTTTTGTGCACCATTCTTTTCCAACTCTATTGAAGCAAAATTGTTGTTTGTAGCCTTAGTAGGATTGCCTTTCTCATCTCCATCTCTTGGTGTTGCATTTCTATAAAAAGCATATAAGGCTAATTGGGCAATACCGGATGCAGCACCCAATCCATTGGGAATAGCAATGTAGATGTCCACTCCACCAATAAATGCGTATCCAAACCACACAAGTCCATTGATAAAATTGAACAATGAAAGCAAAAATGGCATGTACTTTACACTTCGGGTTTGAATTACCATTCTCATGATAGAGAGAGGAGACGCATACATCCCTACCGCAAAAACAGCACAAAGAGTCCCAATGACAGTCTTGCGTTTCTTCTTGTCCTCTATCAATTCCAATACAAGAACCGTCACCGCAATAAAAGAAACCAGAACTAACATTAAGAGCTTCATGACCTTCATCCTTATTTTCTTTTCTGCATTCAGCAAATATAATGTGAGGAATAAAAACTCAATGAAACAGCCAGCTGCATTGATGGTCACAACTAGCACTTGAAACTCCACCACCGGAAGGCCATATACAACCCACAGTAGGCAATTGAGCAATGTACACACATACGGAAAGCCAGAGTAATCTGCCACAGTTTTCTTCTTGACAATTTTGATGAAAGTGGGGATTGGCGACGTAAATAGACAGATCGCAGTGATGTTCCCCAAGACTCCAAGAATTACTTTGAAATCAACGTGACCCATGTTTGCCGCCGCANGTTCCCTCTCGCTCGAGTCTGCTCTGATGAAAAAGTGGTACAATCCACACCTGGACTCACAGTGAANAGCAAGCAACTCCACGAAACCTTCGT


Protein sequences

Name Description Sequence
Ppa.18614 translated coding region predicted by ESTScan from UniGene Ppa.18614

XEGFVELLAXHCESRCGLYHFFIRADSSEREXAAANMGHVDFKVILGVLGNITAICLFTSPIPTFIKIVKKKTVADYSGFPYVCTLLNCLLWVVYGLPVVEFQVLVVTINAAGCFIEFLFLTLYLLNAEKKIRMKVMKLLMLVLVSFIAVTVLVLELIEDKKKRKTVIGTLCAVFAVGMYASPLSIMRMVIQTRSVKYMPFLLSLFNFINGLVWFGYAFIGGVDIYIAIPNGLGAASGIAQLALYAFYRNATPRDGDEKGNPTKATNNNFASIELEKNGAQKQSSHVSKSQTNEIV


Domains

Domain Start-End Description Sequence

Seg: seg
24-35 seg

RADSSEREXAAA

HMMPanther: PTHR10791
IPR004316
45-276 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

ILGVLGNITAICLFTSPIPTFIKIVKKKTVADYSGFPYVCTLLNCLLWVVYGLPVVEFQVLVVTINAAGCFIEFLFLTLYLLNAEKKIRMKVMKLLMLVLVSFIAVTVLVLELIEDKKKRKTVIGTLCAVFAVGMYASPLSIMRMVIQTRSVKYMPFLLSLFNFINGLVWFGYAFIGGVDIYIAIPNGLGAASGIAQLALYAFYRNATPRDGDEKGNPTKATNNNFASIELE

HMMPfam: PF03083
IPR004316
45-130 MtN3_slv
RAG1-activating protein-1-related

ILGVLGNITAICLFTSPIPTFIKIVKKKTVADYSGFPYVCTLLNCLLWVVYGLPVVEFQVLVVTINAAGCFIEFLFLTLYLLNAEK

Seg: seg
134-145 seg

MKVMKLLMLVLV

HMMPfam: PF03083
IPR004316
167-251 MtN3_slv
RAG1-activating protein-1-related

VIGTLCAVFAVGMYASPLSIMRMVIQTRSVKYMPFLLSLFNFINGLVWFGYAFIGGVDIYIAIPNGLGAASGIAQLALYAFYRNA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox