PRGDB00074273 (Ppa.18913)

From PRG Wiki
Jump to: navigation, search
Ppa.18913
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 208387921 (DC929265)
Gene Class Unknown
Domain Type
Gene Species Physcomitrella patens

Comment?

DC929265 ppgs full-length cDNA library; green sporophytes Physcomitrella patens subsp. patens cDNA clone ppgs3i14 5', mRNA sequence

DNA Sequence

AACTTGCTCGTGCGCTCTTAAAAGTTTGCGGCCGTGATGCAGAGAGCGAACAGAAGAAAGAATAAAAAGCCGAGTGTCGAGCAGTTGGCGCTAAGTGTTGTAGACCTGCAGCAGAGAGCAGAGTTCGGTTGCAGACGAAGGTTTCGGTGGAGTTGCTTGCTCTTCACTGTGAGTCCAGGTGTGGATTGTACCACTTTTTCATCAGAGCAGACTCGAGCGAGAGGGAACTTGCGGCGGCAAACATGGGTCACGTTGATTTCAAAGTAATTCTTGGAGTCTTGGGGAACATCACTGCGATCTGTCTATTTACGTCGCCAATCCCCACTTTCATCAAAATTGTCAAGAAGAAAACTGTGGCAGATTACTCTGGCTTTCCGTATGTGTGTACATTGCTCAATTGCCTACTGTGGGTTGTATATGGCCTTCCGGTGGTGGAGTTTCAAGTGCTAGTTGTGACCATCAATGCAGCTGGCTGTTTCATTGAGTTTTTATTCCTCACATTATATTTGCTGAATGCANAAAAGAAAATAAGGATGAANGTCATGAANCTCTTAATGTTANTTCTGGTTTCTTTTATTGCNNTGACNGTTCTTGTATTGNAATTGANANANGACNNNAANANNCNCNNNANTGNCNTTGNNACTCTTTGNGCNGNTTTtncnnnannnannnnnncnncnccncncncnannnnnnnA


Protein sequences

Name Description Sequence
Ppa.18913 translated coding region predicted by ESTScan from UniGene Ppa.18913

XLARALLKVCGRDAESEQKKEXKAECRAVGAKCCRPAAESRVRLQTKVSVELLALHCESRCGLYHFFIRADSSERELAAANMGHVDFKVILGVLGNITAICLFTSPIPTFIKIVKKKTVADYSGFPYVCTLLNCLLWVVYGLPVVEFQVLVVTINAAGCFIEFLFLTLYLLNAXKKIRMXVMXLLMLXLVSFIAXTVLVLXLXXDXXXXXXXXXTLXAXFXXXXXXXPXXXXX


Domains

Domain Start-End Description Sequence

Seg: seg
14-25 seg

AESEQKKEXKAE

HMMPanther: PTHR10791
IPR004316
90-200 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

ILGVLGNITAICLFTSPIPTFIKIVKKKTVADYSGFPYVCTLLNCLLWVVYGLPVVEFQVLVVTINAAGCFIEFLFLTLYLLNAXKKIRMXVMXLLMLXLVSFIAXTVLVL

HMMPfam: PF03083
IPR004316
90-175 MtN3_slv
RAG1-activating protein-1-related

ILGVLGNITAICLFTSPIPTFIKIVKKKTVADYSGFPYVCTLLNCLLWVVYGLPVVEFQVLVVTINAAGCFIEFLFLTLYLLNAXK

Seg: seg
179-190 seg

MXVMXLLMLXLV

Seg: seg
203-214 seg

XXDXXXXXXXXX

Seg: seg
221-233 seg

XXXXXXXPXXXXX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox