PRGDB00074274 (Ppe.480)

From PRG Wiki
Jump to: navigation, search
Ppe.480
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22489015 (BU048938)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PP_LEa0037L20f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0037L20f, mRNA sequence

DNA Sequence

CAGGGGCCTCAGTTTTCTTCATGAGGACCGAATCACAAGTCATATATCGGGACTTTAAGGCTTCCAATATCTTACTAGATTCAGAATTCAATGCGAAGCTTTCTGATTTTGGCTTAGCTAAGGCGGGCCCCACTGGTGACAGGACTCATGTATCTACTCAAGTCATGGGTACTCAAGGCTATGCAGCACCTGAATATGTTGCTACAGGTAGATTGACTGCTAAAAGTGATGTGTATAGTTTTGGTGTTGTATTACTGGAACTATTGTCTGGACGGCGAGCTGTCGATAAAACAAAAGTTGGTGTCGAGCAGAATCTTGTAGACTGGACAAAACCATATTTGGGTGACAGAAGAAAACTATTTCGGATTATGGACACCAAGTTGGAGGGCCAATATCCCCAGAAAGCAGCCTTTACAGCTGCTACTCTTGCTTCACAATGCCTATGCGCAGAATCTAAACTTAGGCCAACAATGTCAGTGGTATTAGCTACGCTGGAACAACTTGAAGCCCCAAAAACTGCAGCCAGAAACTCTCAATCAGAACAGCAGACGCTNTCTGTTCCTCACCGGAAGTCACCAATGCGACAACACCATTCTCCTCTCAATATACACCAAGTGCATCCCCATTGCTATCCCACCGGCAATCTCCACGTGTGCGTTGA


Protein sequences

Name Description Sequence
Ppe.480 translated coding region predicted by ESTScan from UniGene Ppe.480

XGASVFFMRTESQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTQGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKTKVGVEQNLVDWTKPYLGDRRKLFRIMDTKLEGQYPQKAAFTAATLASQCLCAESKLRPTMSVVLATLEQLEAPKTAARNSQSEQQTLSVPHRKSPMRQHHSPLNIHQVHPHCYPTGNLHVCVX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-168 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XGASVFFMRTESQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTQGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKTKVGVEQNLVDWTKPYLGDRRKLFRIMDTKLEGQYPQKAAFTAATLASQCLCAESKLRPTMSVVLATLEQL

HMMSmart: SM00220
IPR002290
1-168 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XGASVFFMRTESQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTQGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKTKVGVEQNLVDWTKPYLGDRRKLFRIMDTKLEGQYPQKAAFTAATLASQCLCAESKLRPTMSVVLATLEQL

Gene3D: G3DSA:1.10.510.10
11-190 no description

ESQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTQGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKTKVGVEQNLVDWTKPYLGDRRKLFRIMDTKLEGQYPQKAAFTAATLASQCLCAESKLRPTMSVVLATLEQLEAPKTAARNSQSEQQTLSVPHR

HMMPanther: PTHR24420:SF897
11-198 SUBFAMILY NOT NAMED

ESQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTQGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKTKVGVEQNLVDWTKPYLGDRRKLFRIMDTKLEGQYPQKAAFTAATLASQCLCAESKLRPTMSVVLATLEQLEAPKTAARNSQSEQQTLSVPHRKSPMRQHH

HMMPanther: PTHR24420
11-198 FAMILY NOT NAMED,FAMILY NOT NAMED

ESQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTQGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKTKVGVEQNLVDWTKPYLGDRRKLFRIMDTKLEGQYPQKAAFTAATLASQCLCAESKLRPTMSVVLATLEQLEAPKTAARNSQSEQQTLSVPHRKSPMRQHH

HMMPfam: PF00069
IPR017442
12-162 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTQGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKTKVGVEQNLVDWTKPYLGDRRKLFRIMDTKLEGQYPQKAAFTAATLASQCLCAESKLRPTMSVVL

superfamily: SSF56112
IPR011009
13-173 Protein kinase-like (PK-like)
Protein kinase-like domain

QVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTQGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKTKVGVEQNLVDWTKPYLGDRRKLFRIMDTKLEGQYPQKAAFTAATLASQCLCAESKLRPTMSVVLATLEQLEAPKT

PatternScan: PS00108
IPR008271
14-26 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox