PRGDB00074275 (Ppe.612)

From PRG Wiki
Jump to: navigation, search
Ppe.612
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22478533 (BU039779)
Gene Class Unknown
Domain Type
Gene Species Prunus persica

Comment?

PP_LEa0003N16f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0003N16f, mRNA sequence

DNA Sequence

CGAAAACTTCCAAATATAAAGCTTCTTCTGATCAGGAGGATGAACGAAACAAGGAAGGTGGTGTGCGTAACAGGAGCATCTGGTTTCATAGCATCCTGGCTGGTGAAGCTCTTACTGGAACGAGCTTATATTGTCAAAGCAACCGTCCGTGACCCAAATGACCCGAAGAAAACAGAACACTTATTGGCACTTGAGGGGGCAAAAGAAAGGCTCCATTTGTTCAAAGCAGATTTGTTAGAAGAAGGATCTTTTGATGCTGTTGTTGATGGATGTGAGGGTGTTTTTCATACAGCATCCCCTGTAATACTTTCATCCACTGACCCACAGACAGAATTAATTGACCCTGCAGTGAAGGGAACCCTTAATGTTCTAAACTCGTGCGTAAAATTCGCTACCGTCAAGAGGGTAGTTTTAACATCTTCTACGGCTGCAGTCATATTCAATGGAAGACCATTGACCCCTGATGTGGTGGTTGATGAAACATGGTTTTCAGATCCTTTTGTTTGTGAGAATTTTAAGAAATGGTATGTTCTTTCAAAAACTTTAGCTGAGGAAGCGGCTTGGAAATTTGCTGAAGGAAATGGGATTGACTTGGTTACCATAAATCCATCCTTTGTGATTGGTCCACTCTTACAACCAAGCCTTAACATCACCGTGGAGATGATTCTCAACTTCAAAAACGATGTTGAAGATGTAAACAGTTCTATTTATTCATGTANTGATG


Protein sequences

Name Description Sequence
Ppe.612 translated coding region predicted by ESTScan from UniGene Ppe.612

RKLPNIKLLLIRRMNETRKVVCVTGASGFIASWLVKLLLERAYIVKATVRDPNDPKKTEHLLALEGAKERLHLFKADLLEEGSFDAVVDGCEGVFHTASPVILSSTDPQTELIDPAVKGTLNVLNSCVKFATVKRVVLTSSTAAVIFNGRPLTPDVVVDETWFSDPFVCENFKKWYVLSKTLAEEAAWKFAEGNGIDLVTINPSFVIGPLLQPSLNITVEMILNFKNDVEDVNSSIYSCXDX

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
8-227 NAD(P)-binding Rossmann-fold domains

LLLIRRMNETRKVVCVTGASGFIASWLVKLLLERAYIVKATVRDPNDPKKTEHLLALEGAKERLHLFKADLLEEGSFDAVVDGCEGVFHTASPVILSSTDPQTELIDPAVKGTLNVLNSCVKFATVKRVVLTSSTAAVIFNGRPLTPDVVVDETWFSDPFVCENFKKWYVLSKTLAEEAAWKFAEGNGIDLVTINPSFVIGPLLQPSLNITVEMILNFKN

HMMPanther: PTHR10366:SF9
10-225 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

LIRRMNETRKVVCVTGASGFIASWLVKLLLERAYIVKATVRDPNDPKKTEHLLALEGAKERLHLFKADLLEEGSFDAVVDGCEGVFHTASPVILSSTDPQTELIDPAVKGTLNVLNSCVKFATVKRVVLTSSTAAVIFNGRPLTPDVVVDETWFSDPFVCENFKKWYVLSKTLAEEAAWKFAEGNGIDLVTINPSFVIGPLLQPSLNITVEMILNF

HMMPanther: PTHR10366
10-225 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

LIRRMNETRKVVCVTGASGFIASWLVKLLLERAYIVKATVRDPNDPKKTEHLLALEGAKERLHLFKADLLEEGSFDAVVDGCEGVFHTASPVILSSTDPQTELIDPAVKGTLNVLNSCVKFATVKRVVLTSSTAAVIFNGRPLTPDVVVDETWFSDPFVCENFKKWYVLSKTLAEEAAWKFAEGNGIDLVTINPSFVIGPLLQPSLNITVEMILNF

Gene3D: G3DSA:3.40.50.720
IPR016040
18-224 no description
NAD(P)-binding domain

RKVVCVTGASGFIASWLVKLLLERAYIVKATVRDPNDPKKTEHLLALEGAKERLHLFKADLLEEGSFDAVVDGCEGVFHTASPVILSSTDPQTELIDPAVKGTLNVLNSCVKFATVKRVVLTSSTAAVIFNGRPLTPDVVVDETWFSDPFVCENFKKWYVLSKTLAEEAAWKFAEGNGIDLVTINPSFVIGPLLQPSLNITVEMILN

HMMPfam: PF01370
IPR001509
21-213 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGASGFIASWLVKLLLERAYIVKATVRDPNDPKKTEHLLALEGAKERLHLFKADLLEEGSFDAVVDGCEGVFHTASPVILSSTDPQTELIDPAVKGTLNVLNSCVKFATVKRVVLTSSTAAVIFNGRPLTPDVVVDETWFSDPFVCENFKKWYVLSKTLAEEAAWKFAEGNGIDLVTINPSFVIGPLLQP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox