PRGDB00074276 (Ppe.620)

From PRG Wiki
Jump to: navigation, search
Ppe.620
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22478550 (BU039796)
Gene Class TNL
Domain Type NBS, TIR, LRR
Gene Species Prunus persica

Comment?

PP_LEa0003O09f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0003O09f, mRNA sequence

DNA Sequence

GAAAACCTAAGGGAAGTTCTCATTCTCCCTATTTTTTCCACTTGTTTTCTCTATATTTTCCAGACTTTGACAGTTCTATGGTCATAGTTACTCTCTGGATTATAATTGTCTataaaaataaataaatgaacaaaaaaacaagaaaagaagaaagCTTCAGTTCTTACCCATCGTGTAAATGCCACCCAGAGAGATTGGAAACTTGAGTAAGTGCATCTCTCCATCTTTGCACATTCTGTTTATTGTCTTTAAAGGTTTCTTCATGCTTAGAGAAGGCTTCCCCAAAATCTGCTTTCTGTTTTCGTACCTCGGATGGATCCACATGATAGAAAACTGGGAGTATTGTTTGTCCCATCAGGTTCATGCATTCAACAGCCTTTACAAGCTCATCCAAGCACCATGTAGAATTGGCATAGTTTCGTGAAAGAATGACAATTACATATCTTGATGCTTCGATTGCTTTCAAGAGTTTTGGAGCTATGGGCTTTCCCCTCTCAAGTTCTTCATCATCTCTAAATGTGAATATTCCTTTCTGTATCAGAGAAGTATACAGAAAGTCTGTGAAATTTGTGCGGGTGTCTTCTCCTCTGAAACTGAGGAACACATCGTATGTCCATCGAGGGGTCGGAGGagaagaagaagaagatgaaga


Protein sequences

Name Description Sequence
Ppe.620 translated coding region predicted by ESTScan from UniGene Ppe.620

SSSSSSSPPTPRWTYDVFLSFRGEDTRTNFTDFLYTSLIQKGIFTFRDDEELERGKPIAPKLLKAIEASRYVIVILSRNYANSTWCLDELVKAVECMNLMGQTILPVFYHVDPSEVRKQKADFGEAFSKHEETFKDNKQNVQRWRDALTQVSNLSGWHLHDG

Domains

Domain Start-End Description Sequence

Seg: seg
1-7 seg

SSSSSSS

superfamily: SSF52200
IPR000157
3-157 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

SSSSSPPTPRWTYDVFLSFRGEDTRTNFTDFLYTSLIQKGIFTFRDDEELERGKPIAPKLLKAIEASRYVIVILSRNYANSTWCLDELVKAVECMNLMGQTILPVFYHVDPSEVRKQKADFGEAFSKHEETFKDNKQNVQRWRDALTQVSNLSGW

Gene3D: G3DSA:3.40.50.10140
12-148 no description

RWTYDVFLSFRGEDTRTNFTDFLYTSLIQKGIFTFRDDEELERGKPIAPKLLKAIEASRYVIVILSRNYANSTWCLDELVKAVECMNLMGQTILPVFYHVDPSEVRKQKADFGEAFSKHEETFKDNKQNVQRWRDAL

ProfileScan: PS50104
IPR000157
13-154 TIR
Toll-Interleukin receptor

WTYDVFLSFRGEDTRTNFTDFLYTSLIQKGIFTFRDDEELERGKPIAPKLLKAIEASRYVIVILSRNYANSTWCLDELVKAVECMNLMGQTILPVFYHVDPSEVRKQKADFGEAFSKHEETFKDNKQNVQRWRDALTQVSNL

HMMSmart: SM00255
IPR000157
14-154 Toll
Toll/interleukin-1 receptor homology (TIR) domain

TYDVFLSFRGEDTRTNFTDFLYTSLIQKGIFTFRDDEELERGKPIAPKLLKAIEASRYVIVILSRNYANSTWCLDELVKAVECMNLMGQTILPVFYHVDPSEVRKQKADFGEAFSKHEETFKDNKQNVQRWRDALTQVSNL

HMMPfam: PF01582
IPR000157
17-149 TIR
Toll-Interleukin receptor

VFLSFRGEDTRTNFTDFLYTSLIQKGIFTFRDDEELERGKPIAPKLLKAIEASRYVIVILSRNYANSTWCLDELVKAVECMNLMGQTILPVFYHVDPSEVRKQKADFGEAFSKHEETFKDNKQNVQRWRDALT

HMMPanther: PTHR23155:SF300
18-156 DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS), PUTATIVE

FLSFRGEDTRTNFTDFLYTSLIQKGIFTFRDDEELERGKPIAPKLLKAIEASRYVIVILSRNYANSTWCLDELVKAVECMNLMGQTILPVFYHVDPSEVRKQKADFGEAFSKHEETFKDNKQNVQRWRDALTQVSNLSG

HMMPanther: PTHR23155
18-156 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSFRGEDTRTNFTDFLYTSLIQKGIFTFRDDEELERGKPIAPKLLKAIEASRYVIVILSRNYANSTWCLDELVKAVECMNLMGQTILPVFYHVDPSEVRKQKADFGEAFSKHEETFKDNKQNVQRWRDALTQVSNLSG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox