PRGDB00074277 (Ppe.726)

From PRG Wiki
Jump to: navigation, search
Ppe.726
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22478733 (BU039979)
Gene Class Unknown
Domain Type
Gene Species Prunus persica

Comment?

PP_LEa0004H20f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0004H20f, mRNA sequence

DNA Sequence

TTGAAGAAAACAGAGAGAATGGAGGAGAGAAAGGAAGAGTATGTGTAACAGGTGGTTCAGGGTTTATAGGGTCTTGGCTGGTCATGAGGCTCCTTGATCATGGCTACTCTGTCAACACCACTGTCAGATCAGACCCAGAGAACAAGAAAGATCTAAGCTTCCTCACAAGTCTACCAGGAGCATCGGCACGGCTAAAAATTTTCAATGCGGATCTCAGCATCCCAGAAAGTTTCAATGCAGCCGTTGAAGGATGCATCGGATTGTTCCATGTTGCTACTCCAGTTGACTTCCAAGATAAGGAACCTGAAGAAGTGGTGACCAAAAGATCAATTGATGGAGCCCTTGGCATTCTAAAGGCATGCTTAAATTCGAAAACTGTGAAACGAGTTGTATACACCTCGAGCGCATCTGCTGTCATGTTGGGCAGCAAGGATTATGTAGAGGAACTGGATGAGAGCTTTTGGAGTGACATAGATTACATTAAAGCCGTCAAGCCATATGGAGGCTCATACATGATTTCAAAGACATTAACTGAAAGGGCAGTTCTTGAATTTTCAAAGAAATATGGATTGGATGTTGTGACAGTCATTCCTTCTTTTGTTGTTGCCCATTCATTTGTCCTAAACTCCCCGGCTCTGTTCAACCATTTTGTCTCTTGCATTTGGTGACTTTGATCAACTTACCTTTATCATCAATACATCTGTGGCGCATGTGGATAAAGTGCCAAAACACACAATTTCCTTTTGAAACTCATGAGGCCAACCGAAAATCAATTGTCTTCAAAGTCATACACTTGAACAATACCTGAAATAATTCTTGAAAATTCCC


Protein sequences

Name Description Sequence
Ppe.726 translated coding region predicted by ESTScan from UniGene Ppe.726

XEENRENGGEKGRVCVTGGSGFIGSWLVMRLLDHGYSVNTTVRSDPENKKDLSFLTSLPGASARLKIFNADLSIPESFNAAVEGCIGLFHVATPVDFQDKEPEEVVTKRSIDGALGILKACLNSKTVKRVVYTSSASAVMLGSKDYVEELDESFWSDIDYIKAVKPYGGSYMISKTLTERAVLEFSKKYGLDVVTVIPSFVVAHSFVLNSPALFNHFVSCIW

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
1-202 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

XEENRENGGEKGRVCVTGGSGFIGSWLVMRLLDHGYSVNTTVRSDPENKKDLSFLTSLPGASARLKIFNADLSIPESFNAAVEGCIGLFHVATPVDFQDKEPEEVVTKRSIDGALGILKACLNSKTVKRVVYTSSASAVMLGSKDYVEELDESFWSDIDYIKAVKPYGGSYMISKTLTERAVLEFSKKYGLDVVTVIPSFVV

HMMPanther: PTHR10366
1-202 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

XEENRENGGEKGRVCVTGGSGFIGSWLVMRLLDHGYSVNTTVRSDPENKKDLSFLTSLPGASARLKIFNADLSIPESFNAAVEGCIGLFHVATPVDFQDKEPEEVVTKRSIDGALGILKACLNSKTVKRVVYTSSASAVMLGSKDYVEELDESFWSDIDYIKAVKPYGGSYMISKTLTERAVLEFSKKYGLDVVTVIPSFVV

Seg: seg
1-13 seg

XEENRENGGEKGR

superfamily: SSF51735
10-202 NAD(P)-binding Rossmann-fold domains

EKGRVCVTGGSGFIGSWLVMRLLDHGYSVNTTVRSDPENKKDLSFLTSLPGASARLKIFNADLSIPESFNAAVEGCIGLFHVATPVDFQDKEPEEVVTKRSIDGALGILKACLNSKTVKRVVYTSSASAVMLGSKDYVEELDESFWSDIDYIKAVKPYGGSYMISKTLTERAVLEFSKKYGLDVVTVIPSFVV

Gene3D: G3DSA:3.40.50.720
IPR016040
13-203 no description
NAD(P)-binding domain

RVCVTGGSGFIGSWLVMRLLDHGYSVNTTVRSDPENKKDLSFLTSLPGASARLKIFNADLSIPESFNAAVEGCIGLFHVATPVDFQDKEPEEVVTKRSIDGALGILKACLNSKTVKRVVYTSSASAVMLGSKDYVEELDESFWSDIDYIKAVKPYGGSYMISKTLTERAVLEFSKKYGLDVVTVIPSFVVA

HMMPfam: PF01370
IPR001509
14-205 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGGSGFIGSWLVMRLLDHGYSVNTTVRSDPENKKDLSFLTSLPGASARLKIFNADLSIPESFNAAVEGCIGLFHVATPVDFQDKEPEEVVTKRSIDGALGILKACLNSKTVKRVVYTSSASAVMLGSKDYVEELDESFWSDIDYIKAVKPYGGSYMISKTLTERAVLEFSKKYGLDVVTVIPSFVVAHS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox