PRGDB00074278 (Ppe.756)

From PRG Wiki
Jump to: navigation, search
Ppe.756
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22478785 (BU040031)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PP_LEa0004K08f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0004K08f, mRNA sequence

DNA Sequence

CACGTGTGGCTTCTCCTCCGAAACATAGTCTCGGAGCACGGCGAAAAAGCTCCAAATGTTGTCTACAAGGGAAAGCTCGATAACGGCCGTTTGGTCGCCGTCAAGCGATTCAACAAGCTGGCCTGGCCCGACTCTCGCCAGTTCCTGGAGGAAGCGAGATCGGTGGGGACGCTGAGGAGCGAGAGATTGGCGAATCTGATTGGATGCTGCTGCGAAGGAGATGAGAGGCTGCTTGTAGCGGAGTTCATGGCTCATGAGACTCTGGCTAAGCATCTGTTTCACTGGGAGAGCCAGCCCATGAGATGGGCTATGAGGTTGAGGGTGGCTCTGTATTTGGCTCAAGCTCTAGACTATTGCAGTGGCAAAGGTCGTGCTCTGTATCATGATCTCAATGCCTACCGGGTCTTGTTTGATCAGGACGGTAATCCCAGGCTGTCATGCTTTGGCCTCATGAAGAACAGCAGGGATGGCAAGAGTTACAGCACTAACCTGGCTTTCACTCCTCCTGAGTACCTCAGGACAGGTAAGGTGACGCAAGAAAGTGTAGTTTACAGCTTTGGAACCTTATTGCTGGATCTTCTAGAGGCAAACATATTCCCCCCAGCCATGCACTATATCTAATTCGTGGCAAGAATTTCCTGATGCT


Protein sequences

Name Description Sequence
Ppe.756 translated coding region predicted by ESTScan from UniGene Ppe.756

HVWLLLRNIVSEHGEKAPNVVYKGKLDNGRLVAVKRFNKLAWPDSRQFLEEARSVGTLRSERLANLIGCCCEGDERLLVAEFMAHETLAKHLFHWESQPMRWAMRLRVALYLAQALDYCSGKGRALYHDLNAYRVLFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGKVTQESVVYSFGTLLLDLLEANIFPPAMHYI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
7-206 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RNIVSEHGEKAPNVVYKGKLDNGRLVAVKRFNKLAWPDSRQFLEEARSVGTLRSERLANLIGCCCEGDERLLVAEFMAHETLAKHLFHWESQPMRWAMRLRVALYLAQALDYCSGKGRALYHDLNAYRVLFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGKVTQESVVYSFGTLLLDLLEANIFPPAMHYI

HMMSmart: SM00220
IPR002290
7-206 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RNIVSEHGEKAPNVVYKGKLDNGRLVAVKRFNKLAWPDSRQFLEEARSVGTLRSERLANLIGCCCEGDERLLVAEFMAHETLAKHLFHWESQPMRWAMRLRVALYLAQALDYCSGKGRALYHDLNAYRVLFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGKVTQESVVYSFGTLLLDLLEANIFPPAMHYI

HMMPanther: PTHR24420:SF457
8-194 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

NIVSEHGEKAPNVVYKGKLDNGRLVAVKRFNKLAWPDSRQFLEEARSVGTLRSERLANLIGCCCEGDERLLVAEFMAHETLAKHLFHWESQPMRWAMRLRVALYLAQALDYCSGKGRALYHDLNAYRVLFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGKVTQESVVYSFGTLLLDLL

HMMPanther: PTHR24420
8-194 FAMILY NOT NAMED,FAMILY NOT NAMED

NIVSEHGEKAPNVVYKGKLDNGRLVAVKRFNKLAWPDSRQFLEEARSVGTLRSERLANLIGCCCEGDERLLVAEFMAHETLAKHLFHWESQPMRWAMRLRVALYLAQALDYCSGKGRALYHDLNAYRVLFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGKVTQESVVYSFGTLLLDLL

HMMPfam: PF07714
IPR001245
20-195 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VVYKGKLDNGRLVAVKRFNKLAWPDSRQFLEEARSVGTLRSERLANLIGCCCEGDERLLVAEFMAHETLAKHLFHWESQPMRWAMRLRVALYLAQALDYCSGKGRALYHDLNAYRVLFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGKVTQESVVYSFGTLLLDLLE

superfamily: SSF56112
IPR011009
20-194 Protein kinase-like (PK-like)
Protein kinase-like domain

VVYKGKLDNGRLVAVKRFNKLAWPDSRQFLEEARSVGTLRSERLANLIGCCCEGDERLLVAEFMAHETLAKHLFHWESQPMRWAMRLRVALYLAQALDYCSGKGRALYHDLNAYRVLFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGKVTQESVVYSFGTLLLDLL

Gene3D: G3DSA:3.30.200.20
20-75 no description

VVYKGKLDNGRLVAVKRFNKLAWPDSRQFLEEARSVGTLRSERLANLIGCCCEGDE

HMMSmart: SM00219
IPR020635
20-206 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VVYKGKLDNGRLVAVKRFNKLAWPDSRQFLEEARSVGTLRSERLANLIGCCCEGDERLLVAEFMAHETLAKHLFHWESQPMRWAMRLRVALYLAQALDYCSGKGRALYHDLNAYRVLFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGKVTQESVVYSFGTLLLDLLEANIFPPAMHYI

Gene3D: G3DSA:1.10.510.10
76-195 no description

RLLVAEFMAHETLAKHLFHWESQPMRWAMRLRVALYLAQALDYCSGKGRALYHDLNAYRVLFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGKVTQESVVYSFGTLLLDLLE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox