PRGDB00074279 (Ppe.846)

From PRG Wiki
Jump to: navigation, search
Ppe.846
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22480275 (BU040198)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PP_LEa0005C23f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0005C23f, mRNA sequence

DNA Sequence

AGTAAGAAGGATCCGCTTACGTCTGGTTGGAATGAGAGATATAAGGTTGCTGTTGGTGTAGCTGAGGCCTTGGATTATCTGCACACCAGCAGTGCTCAACCTGTAATCCACAGGGATGTCAAGTCATCCAATATTCTACTATCTGATGATTTTGAGCCACAGCTCTCTGATTTTGGACTGGCAAAATGGGCATCAACCTCCTCTTCACATATAACATGCACTGATGTTGCAGGCACCTTTGGCTACTTGGCTCCTGAATACTTTATGTATGGCAAAGTAAACGACAAGATTGACGTATATGCATTCGGTGTCGTACTCCTTGAGCTTCTTTCTGGAAGAAAGCCTATAAGCAGTGACTATCCAAAAGGCCATGAGAGCCTGGTCATGTGGGCCAAGCCAATTCTAAGCGGTGGGAAGGTGTCTCAACTATTATATCCGTGCTTTNGCCCTGACTACAACTCCGACCCCATTGAGAGAATGgtttttaccccccctctttgttttagacatgccccacgagctttgccccccaatgagcttttttGTGAAGCTCCTTCTAGGGGATGCTTATGCCATCTAGTGGGCCCGGCCTTCCCTTTCCTGCTCTGGGACGAATCCGTTGGGCTTCCGGGCCGCTCCCTGTTCTCCCTCCTATTTTGTTGTCCTTACTTCTTCCTTTTCCTGGTCTCCTGTTGGGTGGTCCCctccttcccactgtccctcctgccccgctgcctgtgccccgccccacttccccgccgCGCTCGTGGGCCCAACTCCTCTGCTTTTTCCGCCCCGAAATCTCACAAGAACaaaaaaaacaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.846 translated coding region predicted by ESTScan from UniGene Ppe.846

SKKDPLTSGWNERYKVAVGVAEALDYLHTSSAQPVIHRDVKSSNILLSDDFEPQLSDFGLAKWASTSSSHITCTDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDYPKGHESLVMWAKPILSGGKVSQLLYPCFXPDYNSDPIERMVFTPPLCFRHAPRALPPNELFCEAPSRGCLCHLVGPAFPFLLW

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-173 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

SKKDPLTSGWNERYKVAVGVAEALDYLHTSSAQPVIHRDVKSSNILLSDDFEPQLSDFGLAKWASTSSSHITCTDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDYPKGHESLVMWAKPILSGGKVSQLLYPCFXPDYNSDPIERMVFTPPLCFRHAPR

HMMSmart: SM00220
IPR002290
2-163 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KKDPLTSGWNERYKVAVGVAEALDYLHTSSAQPVIHRDVKSSNILLSDDFEPQLSDFGLAKWASTSSSHITCTDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDYPKGHESLVMWAKPILSGGKVSQLLYPCFXPDYNSDPIERMVFT

HMMPanther: PTHR24420:SF425
9-176 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GWNERYKVAVGVAEALDYLHTSSAQPVIHRDVKSSNILLSDDFEPQLSDFGLAKWASTSSSHITCTDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDYPKGHESLVMWAKPILSGGKVSQLLYPCFXPDYNSDPIERMVFTPPLCFRHAPRALP

HMMPanther: PTHR24420
9-176 FAMILY NOT NAMED,FAMILY NOT NAMED

GWNERYKVAVGVAEALDYLHTSSAQPVIHRDVKSSNILLSDDFEPQLSDFGLAKWASTSSSHITCTDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDYPKGHESLVMWAKPILSGGKVSQLLYPCFXPDYNSDPIERMVFTPPLCFRHAPRALP

superfamily: SSF56112
IPR011009
10-185 Protein kinase-like (PK-like)
Protein kinase-like domain

WNERYKVAVGVAEALDYLHTSSAQPVIHRDVKSSNILLSDDFEPQLSDFGLAKWASTSSSHITCTDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDYPKGHESLVMWAKPILSGGKVSQLLYPCFXPDYNSDPIERMVFTPPLCFRHAPRALPPNELFCEAP

Gene3D: G3DSA:1.10.510.10
10-153 no description

WNERYKVAVGVAEALDYLHTSSAQPVIHRDVKSSNILLSDDFEPQLSDFGLAKWASTSSSHITCTDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDYPKGHESLVMWAKPILSGGKVSQLLYPCFXPDYN

HMMPfam: PF00069
IPR017442
10-123 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

WNERYKVAVGVAEALDYLHTSSAQPVIHRDVKSSNILLSDDFEPQLSDFGLAKWASTSSSHITCTDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDYPKG

PatternScan: PS00108
IPR008271
35-47 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox