PRGDB00074280 (Ppe.903)

From PRG Wiki
Jump to: navigation, search
Ppe.903
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 89488928 (DY644722)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

PU3_plate43_C14 PU3 Prunus persica cDNA similar to weakly similar to leucine-rich repeat family protein [Arabidopsis thaliana], mRNA sequence

DNA Sequence

TGTATTTCTCCTGCCTTCTCCACAAACTCTGAAGGAAATGCTTTGCATGCTTTGAGAAGCAGACTCAATGATGCCACCAATGTCCTGCAGAGCTGGGACCCAACTCTGGTCAATCCCTGCACTTGGTTCCACGTTACCTGTGATTCTAATAACCATGTGATCCGTTTGGATTTGGGCAACTCTAACATTTCGGGGAGTTTGGGGCCTGAGCTTGGGGAGCTGAAGCACCTACAGTACTTGGAGCTTTATAGAAATGACATAAGTGGCAAAATCCCAAACGAGTTGGGGAAATTGAAAAGCCTTGTTAGCATGGATTTGTATGACAACAGATTTGAAGGAAAAATCCCCAAATCTTTCTCCAAATTGAAGTCACTCAGATTTCTGCGACTAAACAACAACAAACTAACAGGATCTATTCCAAGGGAGCTCGTCAGCCTTTCTAGCCTGAAAGTTTTTGATGTTTCCAACAATGATCTATGCGGAACAATTCCAGTTGATGGCCCATTCGGGACTTTCTCAATGGAAAGTTTTGAAACAACAGACTTAATGGCCCAGAGCTGAAGGACTGGTACCTACGACTTCGGTTGCTGAGAAGATGCTGGATTCGTCGATCTCTTTAAAGATATACTTGTATTATAAGACAGATTGACTACTATATATAGCTCTGCATGCAATGTATGATGATTGAGTACCTTCTACAAATAATTCGATCGACTCTAGACGCATGTTaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.903 translated coding region predicted by ESTScan from UniGene Ppe.903

CISPAFSTNSEGNALHALRSRLNDATNVLQSWDPTLVNPCTWFHVTCDSNNHVIRLDLGNSNISGSLGPELGELKHLQYLELYRNDISGKIPNELGKLKSLVSMDLYDNRFEGKIPKSFSKLKSLRFLRLNNNKLTGSIPRELVSLSSLKVFDVSNNDLCGTIPVDGPFGTFSMESFETTDLMAQS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF836
2-166 SUBFAMILY NOT NAMED

ISPAFSTNSEGNALHALRSRLNDATNVLQSWDPTLVNPCTWFHVTCDSNNHVIRLDLGNSNISGSLGPELGELKHLQYLELYRNDISGKIPNELGKLKSLVSMDLYDNRFEGKIPKSFSKLKSLRFLRLNNNKLTGSIPRELVSLSSLKVFDVSNNDLCGTIPVD

HMMPanther: PTHR24420
2-166 FAMILY NOT NAMED,FAMILY NOT NAMED

ISPAFSTNSEGNALHALRSRLNDATNVLQSWDPTLVNPCTWFHVTCDSNNHVIRLDLGNSNISGSLGPELGELKHLQYLELYRNDISGKIPNELGKLKSLVSMDLYDNRFEGKIPKSFSKLKSLRFLRLNNNKLTGSIPRELVSLSSLKVFDVSNNDLCGTIPVD

superfamily: SSF52058
5-164 L domain-like,LRR

AFSTNSEGNALHALRSRLNDATNVLQSWDPTLVNPCTWFHVTCDSNNHVIRLDLGNSNISGSLGPELGELKHLQYLELYRNDISGKIPNELGKLKSLVSMDLYDNRFEGKIPKSFSKLKSLRFLRLNNNKLTGSIPRELVSLSSLKVFDVSNNDLCGTIP

Gene3D: G3DSA:3.80.10.10
9-164 no description

NSEGNALHALRSRLNDATNVLQSWDPTLVNPCTWFHVTCDSNNHVIRLDLGNSNISGSLGPELGELKHLQYLELYRNDISGKIPNELGKLKSLVSMDLYDNRFEGKIPKSFSKLKSLRFLRLNNNKLTGSIPRELVSLSSLKVFDVSNNDLCGTIP

HMMPfam: PF08263
IPR013210
9-48 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NSEGNALHALRSRLNDATNVLQSWDPTLVNPCTWFHVTCD

HMMPfam: PF00560
IPR001611
76-98 LRR_1
Leucine-rich repeat

HLQYLELYRNDISGKIPNELGKL

HMMPfam: PF13855
100-159 LRR_8,Leucine rich repeat

SLVSMDLYDNRFEGKIPKSFSKLKSLRFLRLNNNKLTGSIPRELVSLSSLKVFDVSNNDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox