PRGDB00074283 (Ppe.1677)

From PRG Wiki
Jump to: navigation, search
Ppe.1677
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22486099 (BU046022)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PP_LEa0024O21f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0024O21f, mRNA sequence

DNA Sequence

CGCCTCAGGAACTGCACCTAGGGGTGCTCAAGCTGTAAAGGTCCAGCCTATTGAAGTTCCTACTATACCAATAGATGAACTAAAGGAAATTACCGATGGCTTTGGGACAAGTGCTTTGATTGGAGAGGGTTCATATGGAAGAGTATACTATGGCGTACTCAAAAGTGGGCAGCATGCAGCAATCAAGAAGTTAGATGCCAGCAAACAACCTGACGACGAATTTCTGGCGCAGGTTTCTATGGTATCAAGGCTGAAACATGACAATTTTGTTCAATTGCTTGGTTATTGTGTTGATGGGAGTTCCCGTGTTCTTGCCTATGAGTTTGCATCTAATGGATCTCTTCATGATATTCTACATGGAAGGAAAGGTGTTAAAGGAGCACAACCTGGTCCAGTTTTGTCATGGGCACAGCGTGTTAAAATTGCCGTGGGTGCTGCAAAAGGGCTCGAGTATTTGCACGAAAAGGCTGATCCCCACATCATTCATCGCGACATCAAGTCTAGCAATGTGCTAATATTTGATGACGATGTTGCTAAGATTGCGGACTTTGATTTGTCCAATCAAGCTCCTGATAATGCAGCACGTCTTCACTCCACTCGTGTGCTAGGAACTTTTGGTTATCATGCCCCTGAATATGCAATGACTGGACAGTTGAATGCCAAGAGTGATG


Protein sequences

Name Description Sequence
Ppe.1677 translated coding region predicted by ESTScan from UniGene Ppe.1677

XASGTAPRGAQAVKVQPIEVPTIPIDELKEITDGFGTSALIGEGSYGRVYYGVLKSGQHAAIKKLDASKQPDDEFLAQVSMVSRLKHDNFVQLLGYCVDGSSRVLAYEFASNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF870
7-224 SUBFAMILY NOT NAMED

PRGAQAVKVQPIEVPTIPIDELKEITDGFGTSALIGEGSYGRVYYGVLKSGQHAAIKKLDASKQPDDEFLAQVSMVSRLKHDNFVQLLGYCVDGSSRVLAYEFASNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLNAKSD

HMMPanther: PTHR24420
7-224 FAMILY NOT NAMED,FAMILY NOT NAMED

PRGAQAVKVQPIEVPTIPIDELKEITDGFGTSALIGEGSYGRVYYGVLKSGQHAAIKKLDASKQPDDEFLAQVSMVSRLKHDNFVQLLGYCVDGSSRVLAYEFASNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLNAKSD

Gene3D: G3DSA:3.30.200.20
19-95 no description

EVPTIPIDELKEITDGFGTSALIGEGSYGRVYYGVLKSGQHAAIKKLDASKQPDDEFLAQVSMVSRLKHDNFVQLLG

superfamily: SSF56112
IPR011009
21-224 Protein kinase-like (PK-like)
Protein kinase-like domain

PTIPIDELKEITDGFGTSALIGEGSYGRVYYGVLKSGQHAAIKKLDASKQPDDEFLAQVSMVSRLKHDNFVQLLGYCVDGSSRVLAYEFASNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLNAKSD

ProfileScan: PS50011
IPR000719
35-225 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGTSALIGEGSYGRVYYGVLKSGQHAAIKKLDASKQPDDEFLAQVSMVSRLKHDNFVQLLGYCVDGSSRVLAYEFASNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDX

HMMSmart: SM00220
IPR002290
35-223 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FGTSALIGEGSYGRVYYGVLKSGQHAAIKKLDASKQPDDEFLAQVSMVSRLKHDNFVQLLGYCVDGSSRVLAYEFASNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLNAKS

HMMSmart: SM00219
IPR020635
35-225 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGTSALIGEGSYGRVYYGVLKSGQHAAIKKLDASKQPDDEFLAQVSMVSRLKHDNFVQLLGYCVDGSSRVLAYEFASNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDX

HMMPfam: PF00069
IPR017442
39-219 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ALIGEGSYGRVYYGVLKSGQHAAIKKLDASKQPDDEFLAQVSMVSRLKHDNFVQLLGYCVDGSSRVLAYEFASNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQL

PatternScan: PS00107
IPR017441
41-64 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYYGVLKSGQHAAIKK

Gene3D: G3DSA:1.10.510.10
96-224 no description

YCVDGSSRVLAYEFASNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLNAKSD

PatternScan: PS00108
IPR008271
161-173 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNVLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox