PRGDB00074284 (Ppe.1966)

From PRG Wiki
Jump to: navigation, search
Ppe.1966
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22483394 (BU043317)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PP_LEa0015K13f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0015K13f, mRNA sequence

DNA Sequence

CTCACGTTTCCACCCGAGTGATGGGAACTTTTGGGTATCTGGCTCCAGAATATGCTTCAAGTGGAAAACTCACAGACAAGTCAGATGTTTTCTCCTTTGGGGTTATGCTTTTGGAGTTGATTACTGGACGCCGGCCTGTTGATGCATCTCAAACTTTCATGGAGGATAGTTTAGTAGACTGGGCAAGGCCTGTGTTAACTCGAGCGCTAGAAGAAAGAAACTTTGATGGACTGGTTGATCCTAAGCTGCAGAATAGTTTTGACCCCAATGAGATGGCTCGCATGGTTGCTTGTGCTGCAGCTTGTGTACGTCATTCTGCACGGCGTCGGCCTCGAATGAGTCAGGTTGTCCGTGCTTTAGAGGGAGATGTGTCTTTGTCTGATCTCAATGAAGGAATCAGGCCCGGGCAGAGCAATGTCTATAGTTCATATGGGAGCTCAGACTATGACACAAGCCAGTACAAAGAGGACATGAAAAAATTCAGGAAGATGGCACTGGGAAGCCAGGAGTATGGTGGTAGCAGCGAGTATAGTGCACCCACCAGTGAGTATGGCTTGTACCCGTCTGGCTCAAGCAGCGGTGAAGGCCAAAGCCGCCTAACAACCCGAGAAATGGAGATGGGAAGGATTAAGAACAGTAAAGGTTTTAGTG


Protein sequences

Name Description Sequence
Ppe.1966 translated coding region predicted by ESTScan from UniGene Ppe.1966

XHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSFGVMLLELITGRRPVDASQTFMEDSLVDWARPVLTRALEERNFDGLVDPKLQNSFDPNEMARMVACAAACVRHSARRRPRMSQVVRALEGDVSLSDLNEGIRPGQSNVYSSYGSSDYDTSQYKEDMKKFRKMALGSQEYGGSSEYSAPTSEYGLYPSGSSSGEGQSRLTTREMEMGRIKNSKGFSX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-126 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSFGVMLLELITGRRPVDASQTFMEDSLVDWARPVLTRALEERNFDGLVDPKLQNSFDPNEMARMVACAAACVRHSARRRPRMSQVVRALEGDVSL

HMMPanther: PTHR24420:SF822
2-191 SUBFAMILY NOT NAMED

HVSTRVMGTFGYLAPEYASSGKLTDKSDVFSFGVMLLELITGRRPVDASQTFMEDSLVDWARPVLTRALEERNFDGLVDPKLQNSFDPNEMARMVACAAACVRHSARRRPRMSQVVRALEGDVSLSDLNEGIRPGQSNVYSSYGSSDYDTSQYKEDMKKFRKMALGSQEYGGSSEYSAPTSEYGLYPSGS

HMMPanther: PTHR24420
2-191 FAMILY NOT NAMED,FAMILY NOT NAMED

HVSTRVMGTFGYLAPEYASSGKLTDKSDVFSFGVMLLELITGRRPVDASQTFMEDSLVDWARPVLTRALEERNFDGLVDPKLQNSFDPNEMARMVACAAACVRHSARRRPRMSQVVRALEGDVSLSDLNEGIRPGQSNVYSSYGSSDYDTSQYKEDMKKFRKMALGSQEYGGSSEYSAPTSEYGLYPSGS

superfamily: SSF56112
IPR011009
4-151 Protein kinase-like (PK-like)
Protein kinase-like domain

STRVMGTFGYLAPEYASSGKLTDKSDVFSFGVMLLELITGRRPVDASQTFMEDSLVDWARPVLTRALEERNFDGLVDPKLQNSFDPNEMARMVACAAACVRHSARRRPRMSQVVRALEGDVSLSDLNEGIRPGQSNVYSSYGSSDYDT

Gene3D: G3DSA:1.10.510.10
4-120 no description

STRVMGTFGYLAPEYASSGKLTDKSDVFSFGVMLLELITGRRPVDASQTFMEDSLVDWARPVLTRALEERNFDGLVDPKLQNSFDPNEMARMVACAAACVRHSARRRPRMSQVVRAL

HMMPfam: PF07714
IPR001245
11-120 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

FGYLAPEYASSGKLTDKSDVFSFGVMLLELITGRRPVDASQTFMEDSLVDWARPVLTRALEERNFDGLVDPKLQNSFDPNEMARMVACAAACVRHSARRRPRMSQVVRAL

Seg: seg
92-104 seg

MARMVACAAACVR

Seg: seg
136-154 seg

GQSNVYSSYGSSDYDTSQY

Seg: seg
167-178 seg

GSQEYGGSSEYS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox