PRGDB00074285 (Ppe.2034)

From PRG Wiki
Jump to: navigation, search
Ppe.2034
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22483124 (BU043047)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PP_LEa0014M06f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0014M06f, mRNA sequence

DNA Sequence

GAATGACTGCTACAAAAACTAAAGAGTTTCTGGCAGAAATAAAAGTTTTGTGCAAGGTTCATCATACAAATCTGGTAGAATTGATTGGTTATGCTGCAAGTGATGATGAGCTCTTCCTTATATATGAATATGCCCAAAAAGGTTCACTTAAAAGTCATTTGCATGATCCTCAGAACAAGGGTCATACATCACTTTCCTGGATCATGAGGGTCCAGATTGCTCTTGATGCTGCTAGAGGTCTTGAGTACATCCATGAGCACACTAAAACTCATTATGTCCACCGCGACATCAAGACAAGCAACATCTTGCTTGATGGTACCTTCAGGGCAAAGATTTCAGATTTTGGGTTGGCAAAAATTTTTGGTAAAACAAGTGAGGGAGAAGCTACGGTAACCAAAGTTGTTGGTACATATGGTTATCTGGCTCCAGAATACTTGAGTGATGGCCGTGCTACTACCAAAAGTGATATTTATGCTTTTGGAGTTGTTCTTTTTGAGCTTATATCAGGAAAGGAGGCTGTTATACGAACTGAAGGCACAGCTACAAAAAATTCTGAAAGACGTTCACTGGTATCTATTATGCAAACAGCTCTTANGAGTGCTCCGGAC


Protein sequences

Name Description Sequence
Ppe.2034 translated coding region predicted by ESTScan from UniGene Ppe.2034

XMTATKTKEFLAEIKVLCKVHHTNLVELIGYAASDDELFLIYEYAQKGSLKSHLHDPQNKGHTSLSWIMRVQIALDAARGLEYIHEHTKTHYVHRDIKTSNILLDGTFRAKISDFGLAKIFGKTSEGEATVTKVVGTYGYLAPEYLSDGRATTKSDIYAFGVVLFELISGKEAVIRTEGTATKNSERRSLVSIMQTALXSAPD

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-203 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XMTATKTKEFLAEIKVLCKVHHTNLVELIGYAASDDELFLIYEYAQKGSLKSHLHDPQNKGHTSLSWIMRVQIALDAARGLEYIHEHTKTHYVHRDIKTSNILLDGTFRAKISDFGLAKIFGKTSEGEATVTKVVGTYGYLAPEYLSDGRATTKSDIYAFGVVLFELISGKEAVIRTEGTATKNSERRSLVSIMQTALXSAPD

HMMPanther: PTHR24420:SF930
2-198 SUBFAMILY NOT NAMED

MTATKTKEFLAEIKVLCKVHHTNLVELIGYAASDDELFLIYEYAQKGSLKSHLHDPQNKGHTSLSWIMRVQIALDAARGLEYIHEHTKTHYVHRDIKTSNILLDGTFRAKISDFGLAKIFGKTSEGEATVTKVVGTYGYLAPEYLSDGRATTKSDIYAFGVVLFELISGKEAVIRTEGTATKNSERRSLVSIMQTAL

HMMPanther: PTHR24420
2-198 FAMILY NOT NAMED,FAMILY NOT NAMED

MTATKTKEFLAEIKVLCKVHHTNLVELIGYAASDDELFLIYEYAQKGSLKSHLHDPQNKGHTSLSWIMRVQIALDAARGLEYIHEHTKTHYVHRDIKTSNILLDGTFRAKISDFGLAKIFGKTSEGEATVTKVVGTYGYLAPEYLSDGRATTKSDIYAFGVVLFELISGKEAVIRTEGTATKNSERRSLVSIMQTAL

HMMSmart: SM00219
IPR020635
2-194 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

MTATKTKEFLAEIKVLCKVHHTNLVELIGYAASDDELFLIYEYAQKGSLKSHLHDPQNKGHTSLSWIMRVQIALDAARGLEYIHEHTKTHYVHRDIKTSNILLDGTFRAKISDFGLAKIFGKTSEGEATVTKVVGTYGYLAPEYLSDGRATTKSDIYAFGVVLFELISGKEAVIRTEGTATKNSERRSLVSIM

HMMSmart: SM00220
IPR002290
2-199 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MTATKTKEFLAEIKVLCKVHHTNLVELIGYAASDDELFLIYEYAQKGSLKSHLHDPQNKGHTSLSWIMRVQIALDAARGLEYIHEHTKTHYVHRDIKTSNILLDGTFRAKISDFGLAKIFGKTSEGEATVTKVVGTYGYLAPEYLSDGRATTKSDIYAFGVVLFELISGKEAVIRTEGTATKNSERRSLVSIMQTALX

Gene3D: G3DSA:3.30.200.20
4-37 no description

ATKTKEFLAEIKVLCKVHHTNLVELIGYAASDDE

HMMPfam: PF00069
IPR017442
6-194 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KTKEFLAEIKVLCKVHHTNLVELIGYAASDDELFLIYEYAQKGSLKSHLHDPQNKGHTSLSWIMRVQIALDAARGLEYIHEHTKTHYVHRDIKTSNILLDGTFRAKISDFGLAKIFGKTSEGEATVTKVVGTYGYLAPEYLSDGRATTKSDIYAFGVVLFELISGKEAVIRTEGTATKNSERRSLVSIM

superfamily: SSF56112
IPR011009
8-171 Protein kinase-like (PK-like)
Protein kinase-like domain

KEFLAEIKVLCKVHHTNLVELIGYAASDDELFLIYEYAQKGSLKSHLHDPQNKGHTSLSWIMRVQIALDAARGLEYIHEHTKTHYVHRDIKTSNILLDGTFRAKISDFGLAKIFGKTSEGEATVTKVVGTYGYLAPEYLSDGRATTKSDIYAFGVVLFELISGK

Gene3D: G3DSA:1.10.510.10
38-175 no description

LFLIYEYAQKGSLKSHLHDPQNKGHTSLSWIMRVQIALDAARGLEYIHEHTKTHYVHRDIKTSNILLDGTFRAKISDFGLAKIFGKTSEGEATVTKVVGTYGYLAPEYLSDGRATTKSDIYAFGVVLFELISGKEAVI

PatternScan: PS00108
IPR008271
92-104 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

YVHRDIKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox