PRGDB00074286 (Ppe.2713)

From PRG Wiki
Jump to: navigation, search
Ppe.2713
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209177970 (FC861466)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PPN077D03-T7 PPN Prunus persica cDNA clone PPN077D03, mRNA sequence

DNA Sequence

GAGCTTGGCCGTGGTGGATTTGGGGTGGTTTATAAGGGAGAATTGGATGATGGGACAAAAATAGCAGTGAAAAGGATGGAGGCGGGCGTGATTTGCAACAAAGCCTTGGATGAATTCCAGGCTGAAATTGCAGTTCTTTCAAAGGTCCGGCACCGTCATTTGGTATCACTTTTGGGTTATTGCATTGAAGGAAATGAGAGAATGCTTGTCTATGAATATATGCCTCAAGGGGCTCTAAGCAGGCATCTTTTCCATTGGAAAACCTTCAAAGTAGAGCCTCTCTCTTGGAAGAGGAGGCTAAATATTGCCTTGGATGTTGCTAGGGGGATGGAGTATCTTCACAATCTTGCTCACAAAAGCTTCATACACAGAGATCTTAAATCATCAAATATCTTACTTGCTGACGATTTTAGAGCAAAAGTATCAGATTTCGGATTGGTGAAACTGGCTCCTGATGGTGAAAAATCCGTTGTGACCAGGCTTGCTGGGACTTTTGGTTACTTAGCACCAGAGTATGCCGTGACGGGAAAAATTACAACCAAAGCAGATGTCTTCAGTTTTGGTGTTGTGTTAATGGAACTATTAACTGGAATGATGGCACTGGACGAGGATAGGCCTGAAGAAAGCCAGTACTTGGCTGCATGGTTCTGGCACATAAAATCGAATAATGAGAAACTCATGGCCGCCATTGACCCGGCCATGACAAAAAAGAAGAACATTTGAGAGCATTGCACAACTG


Protein sequences

Name Description Sequence
Ppe.2713 translated coding region predicted by ESTScan from UniGene Ppe.2713

ELGRGGFGVVYKGELDDGTKIAVKRMEAGVICNKALDEFQAEIAVLSKVRHRHLVSLLGYCIEGNERMLVYEYMPQGALSRHLFHWKTFKVEPLSWKRRLNIALDVARGMEYLHNLAHKSFIHRDLKSSNILLADDFRAKVSDFGLVKLAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGMMALDEDRPEESQYLAAWFWHIKSNNEKLMAAIDPAMTKKKNIXEHCTTX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-247 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ELGRGGFGVVYKGELDDGTKIAVKRMEAGVICNKALDEFQAEIAVLSKVRHRHLVSLLGYCIEGNERMLVYEYMPQGALSRHLFHWKTFKVEPLSWKRRLNIALDVARGMEYLHNLAHKSFIHRDLKSSNILLADDFRAKVSDFGLVKLAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGMMALDEDRPEESQYLAAWFWHIKSNNEKLMAAIDPAMTKKKNIXEHCTTX

HMMPfam: PF07714
IPR001245
1-199 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ELGRGGFGVVYKGELDDGTKIAVKRMEAGVICNKALDEFQAEIAVLSKVRHRHLVSLLGYCIEGNERMLVYEYMPQGALSRHLFHWKTFKVEPLSWKRRLNIALDVARGMEYLHNLAHKSFIHRDLKSSNILLADDFRAKVSDFGLVKLAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGMM

superfamily: SSF56112
IPR011009
1-231 Protein kinase-like (PK-like)
Protein kinase-like domain

ELGRGGFGVVYKGELDDGTKIAVKRMEAGVICNKALDEFQAEIAVLSKVRHRHLVSLLGYCIEGNERMLVYEYMPQGALSRHLFHWKTFKVEPLSWKRRLNIALDVARGMEYLHNLAHKSFIHRDLKSSNILLADDFRAKVSDFGLVKLAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGMMALDEDRPEESQYLAAWFWHIKSNNEKLMAAID

Gene3D: G3DSA:3.30.200.20
1-59 no description

ELGRGGFGVVYKGELDDGTKIAVKRMEAGVICNKALDEFQAEIAVLSKVRHRHLVSLLG

HMMSmart: SM00220
IPR002290
1-246 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

ELGRGGFGVVYKGELDDGTKIAVKRMEAGVICNKALDEFQAEIAVLSKVRHRHLVSLLGYCIEGNERMLVYEYMPQGALSRHLFHWKTFKVEPLSWKRRLNIALDVARGMEYLHNLAHKSFIHRDLKSSNILLADDFRAKVSDFGLVKLAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGMMALDEDRPEESQYLAAWFWHIKSNNEKLMAAIDPAMTKKKNIXEHCTT

HMMSmart: SM00219
IPR020635
1-230 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ELGRGGFGVVYKGELDDGTKIAVKRMEAGVICNKALDEFQAEIAVLSKVRHRHLVSLLGYCIEGNERMLVYEYMPQGALSRHLFHWKTFKVEPLSWKRRLNIALDVARGMEYLHNLAHKSFIHRDLKSSNILLADDFRAKVSDFGLVKLAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGMMALDEDRPEESQYLAAWFWHIKSNNEKLMAAI

HMMPanther: PTHR24420:SF467
2-234 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LGRGGFGVVYKGELDDGTKIAVKRMEAGVICNKALDEFQAEIAVLSKVRHRHLVSLLGYCIEGNERMLVYEYMPQGALSRHLFHWKTFKVEPLSWKRRLNIALDVARGMEYLHNLAHKSFIHRDLKSSNILLADDFRAKVSDFGLVKLAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGMMALDEDRPEESQYLAAWFWHIKSNNEKLMAAIDPAM

HMMPanther: PTHR24420
2-234 FAMILY NOT NAMED,FAMILY NOT NAMED

LGRGGFGVVYKGELDDGTKIAVKRMEAGVICNKALDEFQAEIAVLSKVRHRHLVSLLGYCIEGNERMLVYEYMPQGALSRHLFHWKTFKVEPLSWKRRLNIALDVARGMEYLHNLAHKSFIHRDLKSSNILLADDFRAKVSDFGLVKLAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGMMALDEDRPEESQYLAAWFWHIKSNNEKLMAAIDPAM

PatternScan: PS00107
IPR017441
2-24 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGVVYKGELDDGTKIAVK

Gene3D: G3DSA:1.10.510.10
60-208 no description

YCIEGNERMLVYEYMPQGALSRHLFHWKTFKVEPLSWKRRLNIALDVARGMEYLHNLAHKSFIHRDLKSSNILLADDFRAKVSDFGLVKLAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGMMALDEDRPEE

PatternScan: PS00108
IPR008271
121-133 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FIHRDLKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox