PRGDB00074287 (Ppe.3082)

From PRG Wiki
Jump to: navigation, search
Ppe.3082
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 89484037 (DY639831)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PU2_plate5_I10 PU2 Prunus persica cDNA similar to weakly similar to leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase [Arabidopsis thaliana] contains InterProScan IPR000719:Protein kinase, mRNA sequence

DNA Sequence

CATTTTCCTCAACTCTCAAGGATATGGTTGTGTGTGTGACATTGGTTTGGCAACACTGATGAGCCCAATGCCCCCGCCCGCAGCGCGTGCTGGTGGATACAGATCCCCAGAAGTGACAGACACTCGAAAGTCTTCCCATGCATCCGATGTCTACAGTTTCGGGGTCCTGATACTTGAGCTCCTCACTGGAAAAAGCCCCATACACACAACAGGTGGTGAAGAAGTTATCCACTTGGTAAGGTGGGTGAACTCTGTGGTCAGGGAGGAATGGACAGCAGAAGTGTTTGATGTAGAGCTCTTGAGGTATCCAAACATAGAGGAGGAAATGGTAGAGATGTTGCAAATAGGAATGTCTTGCGTGGCTAGAATGCCGGAGCAACGACCAAGCATGCCGGATGTGGTTAAAAGGGTGGAGGAAATTCGTCAAGTCAACACTGGAAATCCACCATCCTCATCAGGAATATCTACCCCAGTCTTAACACCTCCACCTCCTACGGCCGAGATAGGATCCTCCTCTCAGCCACAGTGAAATTCATTCTACATAGTCAAGTTGTTAGTTATTATAATATAAATTTATTTTTATCTTTCAAATTCAATTGAAATTCGTTCGAATCTATGACAGCTAGTGC


Protein sequences

Name Description Sequence
Ppe.3082 translated coding region predicted by ESTScan from UniGene Ppe.3082

XIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRVEEIRQVNTGNPPSSSGISTPVLTPPPPTAEIGSSSQPQ

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-141 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRVEEI

Gene3D: G3DSA:1.10.510.10
2-137 no description

IFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKR

HMMPfam: PF00069
IPR017442
2-136 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

IFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVK

superfamily: SSF56112
IPR011009
2-146 Protein kinase-like (PK-like)
Protein kinase-like domain

IFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRVEEIRQVNT

HMMPanther: PTHR24420:SF850
2-152 SUBFAMILY NOT NAMED

IFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRVEEIRQVNTGNPPSS

HMMPanther: PTHR24420
2-152 FAMILY NOT NAMED,FAMILY NOT NAMED

IFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRVEEIRQVNTGNPPSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox