PRGDB00074288 (Ppe.3202)

From PRG Wiki
Jump to: navigation, search
Ppe.3202
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 270358333 (GU189298)
Gene Class Mlo-like
Domain Type MLO
Gene Species Prunus persica

Comment?

Prunus persica powdery mildew resistance locus O protein (Mlo) mRNA, complete cds

DNA Sequence

ATGGCAGCATCAGAGAGTAGCTCACAGTCGAGGGAGCTTGACCGTACACCCACATGGGCTGTTTCTGGTGTCTGCGCCGTTATCATCATCATCTCATTGGTTTTGGAGAAGGTCCTTCACAAAGTTGGAACGTTCCTCACGGATAGGCACAAGAGAGCTCTGTTTGAAGCTCTGGAGAAAGTTAAAGCAGAGTTGATGATTCTGGGCTTTATTTCACTACTCCTGACTTTTGGGCAGAGTTACATTGCCAGAATCTGTATTCCACTCAAAATTGCAGATACTATGCTGCCATGTACTGTAAAAGATGTAAAAGATGAGGAGGATGACTCAACTAGTCACCGGAGACTCTTATGGAATGACCGAAGATCTTTAGCGGCTGCCTCTGATTATAAATGCAAGACTGGGTATGAGCCCTTATATCAATTAATGGATTGCACCATGATCCTTCGAGATTCAGACTTACCCACGAGACATCATTTGTTAGAGCACATACCAGTTTCTGGACTAGGATTCCATTCTTCTTTTATGTTGGATGCTTCCTTTCGACAATTTTTTAGGTCTGTTAGTAAGTCTGACTACTTGGCAGTGCGCAATGGATTCATCACTGTCCATTTAGGTGCAGGAAGTAAATTTAACTTCCAAAAATATATCAAGAGATCATTAGAGGATGACTTCAAGGTCGTTGTTGGAGTTAGTCCTGTATTGTGGGCATCATTTGTGATCTTTTTGCTCCTTAATGTTAAAGGATGGCAGGCATTGTTTTGGGCATCCTTGATCCCTCTCATTATAATCTTACTAGTTGGAACAAAACTTCAAGCGATCCTGACTAAGATGGCCCTAGAAATTACAGAAAGGCATGCAGTGGTTCAAGGGATTCCTTTAGTACAGGCTCTNATAATATTTTGGTTTGCTCGGCCTCAGTTGGTTCTTCATTTTATCCATTTTGCGCTGTTTCAGAATGCATTCCCAAATTATATATTTCTTCTGGATATGGTATTCATTGGGGTTGAAATCTTGCTTCCATGCCAATTTCAAGCTCGCAATCGCAAAAGTATTTTTAGGGGTTGGGGTTCTATGTTTGTGCAGCTACATTACACTTCCACTGTATGCCCTTGTAACTCAGATGGGTTCACACATGAAGAAATCCATCTTTATGAACAAACATCCAAGGCCCTTAAGAAGTGGCACATGGCTGTGAAGAAGAAGCACGGTGGGACCCATGGCGGCAAGTCTCCTACCCAAACCCTGGGTGGTGGGAGCTCAACTCTTTCGACGGTGCACTCCTCCGGAGGACACACGCTGCATCGTTTCAAAACAACTGGTCACTCAACCCGCTCATCTGTCTTTGATGATCATGAGACATCTGATCTTGAAACTGATCCTTTGTCACCCACATCAACTACAAACTTGATTGTAAGAGTGGATCAAATGGAGCAGGAAACTGAAAAAATTGAACCGCAAGACAACGAACAAACCAATAATCCAGACGATTTCTCATTCGCCAAGCCTGCCCCGGATAAAGAAACATGA


Protein sequences

Name Description Sequence
Ppe.3202 translated coding region predicted by ESTScan from UniGene Ppe.3202

MAASESSSQSRELDRTPTWAVSGVCAVIIIISLVLEKVLHKVGTFLTDRHKRALFEALEKVKAELMILGFISLLLTFGQSYIARICIPLKIADTMLPCTVKDVKDEEDDSTSHRRLLWNDRRSLAAASDYKCKTGYEPLYQLMDCTMILRDSDLPTRHHLLEHIPVSGLGFHSSFMLDASFRQFFRSVSKSDYLAVRNGFITVHLGAGSKFNFQKYIKRSLEDDFKVVVGVSPVLWASFVIFLLLNVKGWQALFWASLIPLIIILLVGTKLQAILTKMALEITERHAVVQGIPLVQALIIFWFARPQLVLHFIHFALFQNAFPNYIFLLDMVFIGVEILLPCQFQARNRKSIFRGWGSMFVQLHYTSTVCPCNSDGFTHEEIHLYEQTSKALKKWHMAVKKKHGGTHGGKSPTQTLGGGSSTLSTVHSSGGHTLHRFKTTGHSTRSSVFDDHETSDLETDPLSPTSTTNLIVRVDQMEQETEKIEPQDNEQTNNPDDFSFAKPAPDKET

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
9-141 Mlo
Mlo-related protein

QSRELDRTPTWAVSGVCAVIIIISLVLEKVLHKVGTFLTDRHKRALFEALEKVKAELMILGFISLLLTFGQSYIARICIPLKIADTMLPCTVKDVKDEEDDSTSHRRLLWNDRRSLAAASDYKCKTGYEPLYQ

HMMPfam: PF03094
IPR004326
175-441 Mlo
Mlo-related protein

FMLDASFRQFFRSVSKSDYLAVRNGFITVHLGAGSKFNFQKYIKRSLEDDFKVVVGVSPVLWASFVIFLLLNVKGWQALFWASLIPLIIILLVGTKLQAILTKMALEITERHAVVQGIPLVQALIIFWFARPQLVLHFIHFALFQNAFPNYIFLLDMVFIGVEILLPCQFQARNRKSIFRGWGSMFVQLHYTSTVCPCNSDGFTHEEIHLYEQTSKALKKWHMAVKKKHGGTHGGKSPTQTLGGGSSTLSTVHSSGGHTLHRFKTTG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox