PRGDB00074289 (Ppe.3265)

From PRG Wiki
Jump to: navigation, search
Ppe.3265
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209177326 (FC861931)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PPN059B03-T7 PPN Prunus persica cDNA clone PPN059B03, mRNA sequence

DNA Sequence

ACGGGAATTAGGATCTGGTACATATGGAACTGTTTATCATGGAAAATGGCGGGGAACAGATGTTGCGATCAAGCGAATTAAAAAGAGCTGTTTTGCAGGGAGATCATCAGAGCAAGATCGACTGACAAAAGACTTCTGGAGAGAGGCGCAGATCCTTTCAAATCTTCATCATCCAAATGTGGTTGCATTCTATGGGGTAGTACCCGATGGAGCTGGTGGTACGTTGGCAACTGTAGCTGAATTCATGGTCAATGGGTCACTTAGGCATGCGCTACTTAAAAAGGACAGATCACTTGACCGTCGTAGAAAGCTTATAATTGCAATGGATGCAGCTTTCGGCATGGAATACTTGCATTCAAAGAATATTGTCCATTTTGATTTGAAGTGTGACAATCTGCTAGTCAACTTGAGGGATTCTCAACGACCTATATGCAAGGTTGGAGATTTTGGTTTATCGAGAATCAAACGCAATACTTTGGTATCTGGTGGTGTGCGAGGAACTCTTCCTTGGATGGCACCAGAATTATTAAATGGTAGCAGCAGCCGGGTGTCTGAGAAGGTTGATGTGTTCTCGTTTGGAATTTCAATGTGGGAGATCTTGACTGGGGAGGAACCATACGCGAATATGCATTGTGGTGCCATCATTGGGGGAATCGTGAAGAACACTCTTCGACCTCCTATTCAGAACGTTGTGATTCCGAGTGGAGAATCTGATGGACAGTGCTGTCATCTGATCCTGAATCCGGCATCA


Protein sequences

Name Description Sequence
Ppe.3265 translated coding region predicted by ESTScan from UniGene Ppe.3265

XRELGSGTYGTVYHGKWRGTDVAIKRIKKSCFAGRSSEQDRLTKDFWREAQILSNLHHPNVVAFYGVVPDGAGGTLATVAEFMVNGSLRHALLKKDRSLDRRRKLIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLRDSQRPICKVGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGSSSRVSEKVDVFSFGISMWEILTGEEPYANMHCGAIIGGIVKNTLRPPIQNVVIPSGESDGQCCHLILNPAS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-251 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XRELGSGTYGTVYHGKWRGTDVAIKRIKKSCFAGRSSEQDRLTKDFWREAQILSNLHHPNVVAFYGVVPDGAGGTLATVAEFMVNGSLRHALLKKDRSLDRRRKLIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLRDSQRPICKVGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGSSSRVSEKVDVFSFGISMWEILTGEEPYANMHCGAIIGGIVKNTLRPPIQNVVIPSGESDGQCCHLILNPAS

HMMSmart: SM00219
IPR020635
1-247 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XRELGSGTYGTVYHGKWRGTDVAIKRIKKSCFAGRSSEQDRLTKDFWREAQILSNLHHPNVVAFYGVVPDGAGGTLATVAEFMVNGSLRHALLKKDRSLDRRRKLIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLRDSQRPICKVGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGSSSRVSEKVDVFSFGISMWEILTGEEPYANMHCGAIIGGIVKNTLRPPIQNVVIPSGESDGQCCHLIL

HMMSmart: SM00220
IPR002290
1-251 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XRELGSGTYGTVYHGKWRGTDVAIKRIKKSCFAGRSSEQDRLTKDFWREAQILSNLHHPNVVAFYGVVPDGAGGTLATVAEFMVNGSLRHALLKKDRSLDRRRKLIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLRDSQRPICKVGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGSSSRVSEKVDVFSFGISMWEILTGEEPYANMHCGAIIGGIVKNTLRPPIQNVVIPSGESDGQCCHLILNPAS

Gene3D: G3DSA:3.30.200.20
2-66 no description

RELGSGTYGTVYHGKWRGTDVAIKRIKKSCFAGRSSEQDRLTKDFWREAQILSNLHHPNVVAFYG

HMMPfam: PF07714
IPR001245
2-219 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

RELGSGTYGTVYHGKWRGTDVAIKRIKKSCFAGRSSEQDRLTKDFWREAQILSNLHHPNVVAFYGVVPDGAGGTLATVAEFMVNGSLRHALLKKDRSLDRRRKLIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLRDSQRPICKVGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGSSSRVSEKVDVFSFGISMWEILTGEEPYANMHCGAIIGGI

HMMPanther: PTHR23257:SF68
2-228 SERINE/THREONINE PROTEIN KINASE,Ser-thr,SERINE/THREONINE PROTEIN KINASE

RELGSGTYGTVYHGKWRGTDVAIKRIKKSCFAGRSSEQDRLTKDFWREAQILSNLHHPNVVAFYGVVPDGAGGTLATVAEFMVNGSLRHALLKKDRSLDRRRKLIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLRDSQRPICKVGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGSSSRVSEKVDVFSFGISMWEILTGEEPYANMHCGAIIGGIVKNTLRPPI

HMMPanther: PTHR23257
2-228 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

RELGSGTYGTVYHGKWRGTDVAIKRIKKSCFAGRSSEQDRLTKDFWREAQILSNLHHPNVVAFYGVVPDGAGGTLATVAEFMVNGSLRHALLKKDRSLDRRRKLIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLRDSQRPICKVGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGSSSRVSEKVDVFSFGISMWEILTGEEPYANMHCGAIIGGIVKNTLRPPI

superfamily: SSF56112
IPR011009
2-247 Protein kinase-like (PK-like)
Protein kinase-like domain

RELGSGTYGTVYHGKWRGTDVAIKRIKKSCFAGRSSEQDRLTKDFWREAQILSNLHHPNVVAFYGVVPDGAGGTLATVAEFMVNGSLRHALLKKDRSLDRRRKLIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLRDSQRPICKVGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGSSSRVSEKVDVFSFGISMWEILTGEEPYANMHCGAIIGGIVKNTLRPPIQNVVIPSGESDGQCCHLIL

PatternScan: PS00107
IPR017441
4-29 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGTYGTVYHGKWRGTDVAIKRIKK

Gene3D: G3DSA:1.10.510.10
67-227 no description

VVPDGAGGTLATVAEFMVNGSLRHALLKKDRSLDRRRKLIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLRDSQRPICKVGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGSSSRVSEKVDVFSFGISMWEILTGEEPYANMHCGAIIGGIVKNTLRPP

Seg: seg
92-105 seg

LLKKDRSLDRRRKL

PatternScan: PS00108
IPR008271
123-135 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHFDLKCDNLLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox