PRGDB00074290 (Ppe.3365)

From PRG Wiki
Jump to: navigation, search
Ppe.3365
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 115595206 (AM290057)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

AM290057 Prunus persica fruit skin mature fruit Prunus persica cDNA clone Skin64A06, mRNA sequence

DNA Sequence

GGACATTTGGTACCTGAACTAGGAAAGCTCGAGCATCTTCAATATCTGGAGCTTTACAAAAATAACATTCAAGGAACTATTCCAGCTGACCTTGGTAACTTGAAGAGCCTCGTTAGCTTGGACTTATATAACAACAACATATCAGGGACCATTCCTTCTTCATTGGGGAAATTGAAATCACTTGTGTTTTTACGTCTCAATGATAACAAGTTAACTGGACCAATCCCGCGGGATCTTGTTGGTATTTCAAGCCTCAAAGTTGTGGATGTATCCAACAATGATTTATGTGGAACAATTCCTACCAGTGGACCATTTGAGCACATCCCTTTAAACAACTTTGAGAATAACCATCGACTCGAAGGTCCAGAGTTGTTGGGGCTTGCAACTTATGACACAAACTGCTCATGATGAAGAACGAAGACGGAATCTTGACTCTGCTTTGAATTAGATATGTACGTCCAAAAAGTATATCGTCGCATTTTAATGGGATTGGTTACAAACTCAATCCCCCATATAAGCAAGCATATATGTAAATTTTATGACAGTAAATGGCATCGGCACTTGTAACTGTATCGTTGTGCTCTTGGTAATATGTCGAAGACCTTATTTGCATTGATGTAGTACAAACCAAAGTTCTAGTTATAGTGAATTAATTTGACTCGCTTGCTCACAGTAAA


Protein sequences

Name Description Sequence
Ppe.3365 translated coding region predicted by ESTScan from UniGene Ppe.3365

GHLVPELGKLEHLQYLELYKNNIQGTIPADLGNLKSLVSLDLYNNNISGTIPSSLGKLKSLVFLRLNDNKLTGPIPRDLVGISSLKVVDVSNNDLCGTIPTSGPFEHIPLNNFENNHRLEGPELLGLATYDTNCS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF836
1-123 SUBFAMILY NOT NAMED

GHLVPELGKLEHLQYLELYKNNIQGTIPADLGNLKSLVSLDLYNNNISGTIPSSLGKLKSLVFLRLNDNKLTGPIPRDLVGISSLKVVDVSNNDLCGTIPTSGPFEHIPLNNFENNHRLEGPE

HMMPanther: PTHR24420
1-123 FAMILY NOT NAMED,FAMILY NOT NAMED

GHLVPELGKLEHLQYLELYKNNIQGTIPADLGNLKSLVSLDLYNNNISGTIPSSLGKLKSLVFLRLNDNKLTGPIPRDLVGISSLKVVDVSNNDLCGTIPTSGPFEHIPLNNFENNHRLEGPE

superfamily: SSF52058
1-128 L domain-like,LRR

GHLVPELGKLEHLQYLELYKNNIQGTIPADLGNLKSLVSLDLYNNNISGTIPSSLGKLKSLVFLRLNDNKLTGPIPRDLVGISSLKVVDVSNNDLCGTIPTSGPFEHIPLNNFENNHRLEGPELLGLA

Gene3D: G3DSA:3.80.10.10
2-102 no description

HLVPELGKLEHLQYLELYKNNIQGTIPADLGNLKSLVSLDLYNNNISGTIPSSLGKLKSLVFLRLNDNKLTGPIPRDLVGISSLKVVDVSNNDLCGTIPTS

HMMPfam: PF12799
12-48 LRR_4,Leucine Rich repeats (2 copies)

HLQYLELYKNNIQGTIPADLGNLKSLVSLDLYNNNIS

HMMPfam: PF13504
60-73 LRR_7,Leucine rich repeat

SLVFLRLNDNKLTG

HMMPfam: PF00560
IPR001611
84-102 LRR_1
Leucine-rich repeat

SLKVVDVSNNDLCGTIPTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox