PRGDB00074291 (Ppe.4565)

From PRG Wiki
Jump to: navigation, search
Ppe.4565
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 61997088 (DN676909)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PP_YEa0018G02 Peach developing fruit mesocarp Stage S4 Prunus persica cDNA clone PP_YEa0018G02 5', mRNA sequence

DNA Sequence

TTGGAAAAGAGCTGTTTCACAGGGCGCTCATCAGAGCAAGAAAGACTGACTGTTGAGTTCTGGCGTGAAGCCGAAATTCTTTCGAAGCTTCACCATCCAAATGTGGTTGCATTTTATGGCGTTGTCCAGAATGGACCAGGAGGAACACTAGCCACCGTGACTGAGTTCATGGTGAATGGCTCTCTGAGGCATGTTTTACTTAGCAAGGAGAGACATCTTGATCGTCGTAAGCGGCTCATTATTGCTATGGATGCAGCATTTGGAATGGAATATCTGCATTCAAAAAAACATAGTACACTTTGATTTGAAATGTGACAATTTGCTTGTGAACTTGAAAGACCCTTTACGACCCATTTGCAAGGTTGGAGATTTTGGCTTGTCAAAAATCAAAAGAAACACCTTAGTTACTGGTGGTGTGAGGGGAACCCTACCCTGGATGGCTCCAGAGCTTCTTAATGGTAGCAGTAGTAAGGTTTCTGAAAAGGTTGATGTATTCTCCTTTGGTATTGTCTTATGGGAGATACTAACTGGTGAGGAGCCTTATGCCAATATGCATTATGGAGCAATCATAGGAGGCATTGTGAATAACACATTGAGGCCACCTGTGCCAGGCTATTGTGATTCCGAAGTGGAGTTGCTAATGGNAGCATGCTGGGCTGCTGATCCCATTGCTCGCCCAT


Protein sequences

Name Description Sequence
Ppe.4565 translated coding region predicted by ESTScan from UniGene Ppe.4565

LEKSCFTGRSSEQERLTVEFWREAEILSKLHHPNVVAFYGVVQNGPGGTLATVTEFMVNGSLRHVLLSKERHLDRRKRLIIAMDAAFGMEYLLQKNIVHFDLKCDNLLVNLKDPLRPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLNGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPPVPGYCDSEVELLMXACWAADPIARPX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-227 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LEKSCFTGRSSEQERLTVEFWREAEILSKLHHPNVVAFYGVVQNGPGGTLATVTEFMVNGSLRHVLLSKERHLDRRKRLIIAMDAAFGMEYLLQKNIVHFDLKCDNLLVNLKDPLRPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLNGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPPVPGYCDSEVELLMXACWAADPIARPX

HMMSmart: SM00219
IPR020635
1-226 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LEKSCFTGRSSEQERLTVEFWREAEILSKLHHPNVVAFYGVVQNGPGGTLATVTEFMVNGSLRHVLLSKERHLDRRKRLIIAMDAAFGMEYLLQKNIVHFDLKCDNLLVNLKDPLRPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLNGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPPVPGYCDSEVELLMXACWAADPIARP

HMMSmart: SM00220
IPR002290
1-227 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LEKSCFTGRSSEQERLTVEFWREAEILSKLHHPNVVAFYGVVQNGPGGTLATVTEFMVNGSLRHVLLSKERHLDRRKRLIIAMDAAFGMEYLLQKNIVHFDLKCDNLLVNLKDPLRPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLNGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPPVPGYCDSEVELLMXACWAADPIARPX

HMMPanther: PTHR23257:SF68
3-226 SERINE/THREONINE PROTEIN KINASE,Ser-thr,SERINE/THREONINE PROTEIN KINASE

KSCFTGRSSEQERLTVEFWREAEILSKLHHPNVVAFYGVVQNGPGGTLATVTEFMVNGSLRHVLLSKERHLDRRKRLIIAMDAAFGMEYLLQKNIVHFDLKCDNLLVNLKDPLRPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLNGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPPVPGYCDSEVELLMXACWAADPIARP

HMMPanther: PTHR23257
3-226 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

KSCFTGRSSEQERLTVEFWREAEILSKLHHPNVVAFYGVVQNGPGGTLATVTEFMVNGSLRHVLLSKERHLDRRKRLIIAMDAAFGMEYLLQKNIVHFDLKCDNLLVNLKDPLRPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLNGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPPVPGYCDSEVELLMXACWAADPIARP

Gene3D: G3DSA:3.30.200.20
10-66 no description

SSEQERLTVEFWREAEILSKLHHPNVVAFYGVVQNGPGGTLATVTEFMVNGSLRHVL

HMMPfam: PF07714
IPR001245
11-226 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SEQERLTVEFWREAEILSKLHHPNVVAFYGVVQNGPGGTLATVTEFMVNGSLRHVLLSKERHLDRRKRLIIAMDAAFGMEYLLQKNIVHFDLKCDNLLVNLKDPLRPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLNGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPPVPGYCDSEVELLMXACWAADPIARP

superfamily: SSF56112
IPR011009
14-226 Protein kinase-like (PK-like)
Protein kinase-like domain

ERLTVEFWREAEILSKLHHPNVVAFYGVVQNGPGGTLATVTEFMVNGSLRHVLLSKERHLDRRKRLIIAMDAAFGMEYLLQKNIVHFDLKCDNLLVNLKDPLRPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLNGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPPVPGYCDSEVELLMXACWAADPIARP

FPrintScan: PR00109
IPR001245
54-67 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEFMVNGSLRHVLL

Gene3D: G3DSA:1.10.510.10
67-226 no description

LSKERHLDRRKRLIIAMDAAFGMEYLLQKNIVHFDLKCDNLLVNLKDPLRPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLNGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPPVPGYCDSEVELLMXACWAADPIARP

FPrintScan: PR00109
IPR001245
91-109 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLLQKNIVHFDLKCDNLLV

PatternScan: PS00108
IPR008271
97-109 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHFDLKCDNLLV

FPrintScan: PR00109
IPR001245
162-184 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VDVFSFGIVLWEILTGEEPYANM

FPrintScan: PR00109
IPR001245
206-227 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CDSEVELLMXACWAADPIARPX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox