PRGDB00074292 (Ppe.4617)

From PRG Wiki
Jump to: navigation, search
Ppe.4617
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 51915556 (AJ822034)
Gene Class Unknown
Domain Type
Gene Species Prunus persica

Comment?

AJ822034 S4 Prunus persica cDNA clone S410G23, mRNA sequence

DNA Sequence

GCACGAGGGAAGGGCATGCTAGACCAAATCATGGACCCAAATCTGGTAGGGAAGGTAAATCCAGCTTCTCTTAAGAAGTTTGGGGAGACAGCTGAGAAGTGCCTTGCTGAGTATGGTGTTGACAGGCCATCAATGGGAGATGTCTTGTGGAATCTTGAATATGCTCTTCAGCTTGAGGAAACGTCATCTGCACTCATGGAACCTGAAGATAATAGCACAAACCACATACCTGGTATCCAATTAACCCCACTTGAGCCATTTGATAACAGTGTGAGCATGATTGATGGGGGGCACTCCGGCACAGATGAAGATGCAGAAGATGCTGCCACAAGTGCTGTGTTTTCTCAGCTTGTTAATCCTCGCGGAAGATGAGAAGACAGATCATTTGCCTGTCTGAGTCTTGGTCCCATTAAAAGATACTAGTCATCTTGGCCTTGAGAGTGCTCAGTGAGGGAACAAGGTTCTTTCTTAGTTCATTATTCTTGTTGTTGCCACAATTTTCTGTCTACGATTTATTTTGTAATATAGTTTTGGTGGGTGCCAATTAATCCATCAGCAGGTAAGGTGCCAAAGGATTTTATTATTGTCTTCATATATAAATCCATCTGGGTTTCAGAGCTTCCCATGTTTTTACaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.4617 translated coding region predicted by ESTScan from UniGene Ppe.4617

ARGKGMLDQIMDPNLVGKVNPASLKKFGETAEKCLAEYGVDRPSMGDVLWNLEYALQLEETSSALMEPEDNSTNHIPGIQLTPLEPFDNSVSMIDGGHSGTDEDAEDAATSAVFSQLVNPRGR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF550
4-123 SUBFAMILY NOT NAMED

KGMLDQIMDPNLVGKVNPASLKKFGETAEKCLAEYGVDRPSMGDVLWNLEYALQLEETSSALMEPEDNSTNHIPGIQLTPLEPFDNSVSMIDGGHSGTDEDAEDAATSAVFSQLVNPRGR

HMMPanther: PTHR24420
4-123 FAMILY NOT NAMED,FAMILY NOT NAMED

KGMLDQIMDPNLVGKVNPASLKKFGETAEKCLAEYGVDRPSMGDVLWNLEYALQLEETSSALMEPEDNSTNHIPGIQLTPLEPFDNSVSMIDGGHSGTDEDAEDAATSAVFSQLVNPRGR

Seg: seg
101-110 seg

TDEDAEDAAT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox