PRGDB00074293 (Ppe.4948)

From PRG Wiki
Jump to: navigation, search
Ppe.4948
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 50234591 (AY645718)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

Prunus persica S-locus-like receptor protein kinase (srkl1) mRNA, partial cds

DNA Sequence

AAGTGTGTATTGGCCTGGGCCTGGTTTGAGTGTATATCAGAATGGTAGAACAGACTACAATAGTAGTAGAATTGCTGTTTTTGATGAAATGGGCAATTTTGTATCCAGTGATGACTTGATATTCAGTGCTTCTGACATGGGTGCAAGGGTGAAACGAAGGTTGACAACGGATTATGATGGAAACCTGAGACTTTATAGTCTAAACTCGACAGGATCATGGGTGATCACCTGGGAAGCTCTAGCACAGCAGTGCAGGGTGCATGGGATCTGTGGGAGAAATGGGATTTGTGTTTATACACCAGAGCTTAAGTGCTCGTGCCTTCCTGGCTATGAGGCAGTGGATACAAGTAACTGGAACAAGGGTTGCAAGCCTAAGTTCAAGCCTACATGCTCTCAGTCCCAGAGAGTGAAATTCAAGCAGATTCAGTACGTAGATTTCTATGGATTTGATCTCAATTACAGTGAATCCACTTCCATTCAGAATTGCACAAAACTCTGTGTCGAGGATTGCCGTTGTGAAGCATTTGTCTATAGGGGACAGAAGTGTTACACAAAAGGTGCTCTCTTCAGTGGGCTCAGGTCTCCAACTATCGAGGGCAGTCTATACTTAAGGCTGCCTGAGCCTCTGAGTATGGAAACCTCACCAGCGGCCAATCTCACTGTATTTAATTCATGCAGGACTAATGCTGTTAAAATAGGTACTTCTTCAATGTATGACAATCCCAGTAAAACGGTGAGATGGGTATATCTGTATTCTTTTGCTGCTGCAATCGGTGCTGTTGAATTTCTCTTCATATTATCAGGTTGGTGGTTCTTTTTCAGAAGATCACAAGGTATGTCAGCTCCCTTGGTAGATAAATATCGCTTGATTTCAAGTAACTTTAGAATGTATCTCTATGCTGAGCTGAAGAAAGCAACCAGAAACTTCAAGGAAGAACTGGGAAGAGGGGGTTCTGGGACTGTATATAAGGGTGTTTTGGCCGATGAAAGAGTGATAGCTGTCAAGGCATTGGCAGATATTTATCAAGCGGAAGAAGTATTTTGGGCAGAAGTCAGCACAATTGAAAAAATCAATCACATGAACCTAGTGAGAACTTGGGGATTCTGTTCTGAAGGTAAACACAGACTTCTAATCTCTGAATATGTTGAAAATGGATCCTTGGATAAGCACTTGTTTCCCCCAAATTTTCTTGGATGGAAAGAGAGGTTCAAAGTTGCAATCGGGATAGCTAAAGGTTTAGCCTATCTTCACCATGAGTGTCTAGAATGGGTTATCCATTGTGATGTGAAGCCTGAAAATATACTCCTAGACAGTAATTTTGAACCAAAGATTGCAGATTTCGGGCTGGCAAAGTTATTCCAGAGAGGCGGCCTCAATGCAGTGTCCTCTCACATTCGAGGAACAAAAGGGTATATGGCCCCGGAGTGGGCTCTGAACCTTTCAATCACTGCAAAAGTGGATGTTTACAGTTATGGTGTAGTGCTTCTAGAGATAGTGAAGGGCATTCGACTTTCAAATCGGGTGGTGGATACTGCTGAGGAGGAAGAAGCAGAGATGAAGAGGTTTGTCAGGATAGCCAGAAGGAAAATTCAATGTGGGGAAGATGAATGGATAGAGGATATGTTGGATCCAAGATTGGAAGGGCAGTTCGGCAGGAACCAAGCAGCAAAGATGGTTGAGGTTGGTATTTCCTGTGTAGAGGAAGATAGGAACAAAAGACCAACAATGGATTCAGTAGTGCAAATGTTGCTAGAATGTGAAGAGGAATCCAACATTCAGTAGTAATTGGATTTAAGCTGTATGCTGTAAGTAATGTTTCTTTTTGAATTACAAATGTTTACTTGAACTATGTTGTGTATTCGTCGGCAAATGAGTGATAAAATATAGATTATGATTaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.4948 translated coding region predicted by ESTScan from UniGene Ppe.4948

XSVYWPGPGLSVYQNGRTDYNSSRIAVFDEMGNFVSSDDLIFSASDMGARVKRRLTTDYDGNLRLYSLNSTGSWVITWEALAQQCRVHGICGRNGICVYTPELKCSCLPGYEAVDTSNWNKGCKPKFKPTCSQSQRVKFKQIQYVDFYGFDLNYSESTSIQNCTKLCVEDCRCEAFVYRGQKCYTKGALFSGLRSPTIEGSLYLRLPEPLSMETSPAANLTVFNSCRTNAVKIGTSSMYDNPSKTVRWVYLYSFAAAIGAVEFLFILSGWWFFFRRSQGMSAPLVDKYRLISSNFRMYLYAELKKATRNFKEELGRGGSGTVYKGVLADERVIAVKALADIYQAEEVFWAEVSTIEKINHMNLVRTWGFCSEGKHRLLISEYVENGSLDKHLFPPNFLGWKERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDSNFEPKIADFGLAKLFQRGGLNAVSSHIRGTKGYMAPEWALNLSITAKVDVYSYGVVLLEIVKGIRLSNRVVDTAEEEEAEMKRFVRIARRKIQCGEDEWIEDMLDPRLEGQFGRNQAAKMVEVGISCVEEDRNKRPTMDSVVQMLLECEEESNIQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF589
3-586 OS06G0602500 PROTEIN

VYWPGPGLSVYQNGRTDYNSSRIAVFDEMGNFVSSDDLIFSASDMGARVKRRLTTDYDGNLRLYSLNSTGSWVITWEALAQQCRVHGICGRNGICVYTPELKCSCLPGYEAVDTSNWNKGCKPKFKPTCSQSQRVKFKQIQYVDFYGFDLNYSESTSIQNCTKLCVEDCRCEAFVYRGQKCYTKGALFSGLRSPTIEGSLYLRLPEPLSMETSPAANLTVFNSCRTNAVKIGTSSMYDNPSKTVRWVYLYSFAAAIGAVEFLFILSGWWFFFRRSQGMSAPLVDKYRLISSNFRMYLYAELKKATRNFKEELGRGGSGTVYKGVLADERVIAVKALADIYQAEEVFWAEVSTIEKINHMNLVRTWGFCSEGKHRLLISEYVENGSLDKHLFPPNFLGWKERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDSNFEPKIADFGLAKLFQRGGLNAVSSHIRGTKGYMAPEWALNLSITAKVDVYSYGVVLLEIVKGIRLSNRVVDTAEEEEAEMKRFVRIARRKIQCGEDEWIEDMLDPRLEGQFGRNQAAKMVEVGISCVEEDRNKRPTMDSVVQMLLE

HMMPanther: PTHR24420
3-586 FAMILY NOT NAMED,FAMILY NOT NAMED

VYWPGPGLSVYQNGRTDYNSSRIAVFDEMGNFVSSDDLIFSASDMGARVKRRLTTDYDGNLRLYSLNSTGSWVITWEALAQQCRVHGICGRNGICVYTPELKCSCLPGYEAVDTSNWNKGCKPKFKPTCSQSQRVKFKQIQYVDFYGFDLNYSESTSIQNCTKLCVEDCRCEAFVYRGQKCYTKGALFSGLRSPTIEGSLYLRLPEPLSMETSPAANLTVFNSCRTNAVKIGTSSMYDNPSKTVRWVYLYSFAAAIGAVEFLFILSGWWFFFRRSQGMSAPLVDKYRLISSNFRMYLYAELKKATRNFKEELGRGGSGTVYKGVLADERVIAVKALADIYQAEEVFWAEVSTIEKINHMNLVRTWGFCSEGKHRLLISEYVENGSLDKHLFPPNFLGWKERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDSNFEPKIADFGLAKLFQRGGLNAVSSHIRGTKGYMAPEWALNLSITAKVDVYSYGVVLLEIVKGIRLSNRVVDTAEEEEAEMKRFVRIARRKIQCGEDEWIEDMLDPRLEGQFGRNQAAKMVEVGISCVEEDRNKRPTMDSVVQMLLE

HMMPfam: PF00954
IPR000858
41-112 S_locus_glycop
S-locus glycoprotein

IFSASDMGARVKRRLTTDYDGNLRLYSLNSTGSWVITWEALAQQCRVHGICGRNGICVYTPELKCSCLPGYE

ProfileScan: PS50948
IPR003609
131-207 PAN
Apple-like

CSQSQRVKFKQIQYVDFYGFDLNYSESTSIQNCTKLCVEDCRCEAFVYRGQKCYTKGALFSGLRSPTIEGSLYLRLP

superfamily: SSF56112
IPR011009
280-592 Protein kinase-like (PK-like)
Protein kinase-like domain

MSAPLVDKYRLISSNFRMYLYAELKKATRNFKEELGRGGSGTVYKGVLADERVIAVKALADIYQAEEVFWAEVSTIEKINHMNLVRTWGFCSEGKHRLLISEYVENGSLDKHLFPPNFLGWKERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDSNFEPKIADFGLAKLFQRGGLNAVSSHIRGTKGYMAPEWALNLSITAKVDVYSYGVVLLEIVKGIRLSNRVVDTAEEEEAEMKRFVRIARRKIQCGEDEWIEDMLDPRLEGQFGRNQAAKMVEVGISCVEEDRNKRPTMDSVVQMLLECEEESN

Gene3D: G3DSA:3.30.200.20
291-369 no description

ISSNFRMYLYAELKKATRNFKEELGRGGSGTVYKGVLADERVIAVKALADIYQAEEVFWAEVSTIEKINHMNLVRTWGF

ProfileScan: PS50011
IPR000719
308-585 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RNFKEELGRGGSGTVYKGVLADERVIAVKALADIYQAEEVFWAEVSTIEKINHMNLVRTWGFCSEGKHRLLISEYVENGSLDKHLFPPNFLGWKERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDSNFEPKIADFGLAKLFQRGGLNAVSSHIRGTKGYMAPEWALNLSITAKVDVYSYGVVLLEIVKGIRLSNRVVDTAEEEEAEMKRFVRIARRKIQCGEDEWIEDMLDPRLEGQFGRNQAAKMVEVGISCVEEDRNKRPTMDSVVQMLL

HMMSmart: SM00219
IPR020635
308-584 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RNFKEELGRGGSGTVYKGVLADERVIAVKALADIYQAEEVFWAEVSTIEKINHMNLVRTWGFCSEGKHRLLISEYVENGSLDKHLFPPNFLGWKERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDSNFEPKIADFGLAKLFQRGGLNAVSSHIRGTKGYMAPEWALNLSITAKVDVYSYGVVLLEIVKGIRLSNRVVDTAEEEEAEMKRFVRIARRKIQCGEDEWIEDMLDPRLEGQFGRNQAAKMVEVGISCVEEDRNKRPTMDSVVQML

HMMSmart: SM00220
IPR002290
308-584 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RNFKEELGRGGSGTVYKGVLADERVIAVKALADIYQAEEVFWAEVSTIEKINHMNLVRTWGFCSEGKHRLLISEYVENGSLDKHLFPPNFLGWKERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDSNFEPKIADFGLAKLFQRGGLNAVSSHIRGTKGYMAPEWALNLSITAKVDVYSYGVVLLEIVKGIRLSNRVVDTAEEEEAEMKRFVRIARRKIQCGEDEWIEDMLDPRLEGQFGRNQAAKMVEVGISCVEEDRNKRPTMDSVVQML

HMMPfam: PF00069
IPR017442
310-582 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FKEELGRGGSGTVYKGVLADERVIAVKALADIYQAEEVFWAEVSTIEKINHMNLVRTWGFCSEGKHRLLISEYVENGSLDKHLFPPNFLGWKERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDSNFEPKIADFGLAKLFQRGGLNAVSSHIRGTKGYMAPEWALNLSITAKVDVYSYGVVLLEIVKGIRLSNRVVDTAEEEEAEMKRFVRIARRKIQCGEDEWIEDMLDPRLEGQFGRNQAAKMVEVGISCVEEDRNKRPTMDSVVQ

PatternScan: PS00107
IPR017441
314-336 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGSGTVYKGVLADERVIAVK

Gene3D: G3DSA:1.10.510.10
370-584 no description

CSEGKHRLLISEYVENGSLDKHLFPPNFLGWKERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDSNFEPKIADFGLAKLFQRGGLNAVSSHIRGTKGYMAPEWALNLSITAKVDVYSYGVVLLEIVKGIRLSNRVVDTAEEEEAEMKRFVRIARRKIQCGEDEWIEDMLDPRLEGQFGRNQAAKMVEVGISCVEEDRNKRPTMDSVVQML

PatternScan: PS00108
IPR008271
425-437 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHCDVKPENILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox