PRGDB00074294 (Ppe.5119)

From PRG Wiki
Jump to: navigation, search
Ppe.5119
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 89480237 (DY636031)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

PU1_plate16_O21 PU1 Prunus persica cDNA similar to similar to leucine-rich repeat family protein

DNA Sequence

CATGATTTCTGGTTTACAACATCCGAATCTTGTTAGATTGTATGGGTGCTGCATTGAAGCAAATCAACTACTGTTGGTATATGAATACATGGAAAACAATAGCCTTGCACGTGCTTTGTTTGGTCCAGAGGAAGGTCCATTAAAATTGGACTGGCCTACAAGGCAGAAAATATGCTTGGGCATAGCAAGAGGTTTGGCTTTTTTGCATGAGGAATCTGCACTGAAGGTTGTGCATAGAGACATCAAAACTACGAATATATTACTGGACCATGACCTTAGCCCTAAGATCTCAGACTTTGGTTTGGCCAAGCTTGATGAAGAGGAGAACACCCACATTAGCACCAGAGTTGCTGGAACTATAGGATACATGGCGCCTGAATATGCACTATGGGGTTATTTAACCTACAAAGCAGATGTCTACAGCTTTGGTGTTGTTGCATTGGAAATTGTTGCTGGAAAGAACAACATGAAATATCGACCAAATGAGAATTTTGTATGCCTTGTGGATTGGGCCCTTGTTTTGCAACAAAAAGGGAATTTAATGGACCTGGTAGATCCAAGGTTGGGGTCCAATTTCAGTAAAGAAGAGGCAATTAGAATGGTTAAAGTGGCTCTGCTATGCACCAATCCTGCA


Protein sequences

Name Description Sequence
Ppe.5119 translated coding region predicted by ESTScan from UniGene Ppe.5119

XMISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDWPTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNPA

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-212 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XMISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDWPTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNPA

HMMSmart: SM00219
IPR020635
1-201 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XMISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDWPTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSKEEAIRM

HMMPanther: PTHR24420:SF696
2-211 LEUCINE-RICH REPEAT FAMILY PROTEIN / PROTEIN KINASE FAMILY PROTEIN

MISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDWPTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNP

HMMPanther: PTHR24420
2-211 FAMILY NOT NAMED,FAMILY NOT NAMED

MISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDWPTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNP

Gene3D: G3DSA:3.30.200.20
2-41 no description

MISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALF

superfamily: SSF56112
IPR011009
2-211 Protein kinase-like (PK-like)
Protein kinase-like domain

MISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDWPTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNP

HMMSmart: SM00220
IPR002290
2-189 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDWPTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLMDLVDPRL

HMMPfam: PF00069
IPR017442
3-160 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDWPTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYR

Gene3D: G3DSA:1.10.510.10
45-208 no description

EGPLKLDWPTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSKEEAIRMVKVALLC

PatternScan: PS00108
IPR008271
77-89 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDIKTTNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox